BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1266 (721 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35838| Best HMM Match : NCD3G (HMM E-Value=0.032) 32 0.54 SB_737| Best HMM Match : 7tm_1 (HMM E-Value=1.9e-35) 29 2.9 SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_35838| Best HMM Match : NCD3G (HMM E-Value=0.032) Length = 589 Score = 31.9 bits (69), Expect = 0.54 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 350 YILESLQHSTFFFTYQRLKGKRY*ATITALYINDRQ*LYSMHKKNIFLG 496 YI+ S + +TF +T+Q++ T Y NDR +YS++ N G Sbjct: 372 YIITSQERTTFTWTFQKISSDFMMTKTTHNYPNDRVKIYSINVTNTISG 420 >SB_737| Best HMM Match : 7tm_1 (HMM E-Value=1.9e-35) Length = 432 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +1 Query: 595 VYCKVNALSLSHICLSSVDMLCMIS*NYFAYIL 693 V CKVNA ++ + L+S+ +C+IS N + I+ Sbjct: 159 VVCKVNAFLITELLLASMLTICVISVNRYLKIV 191 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 571 FRYFNFKLVYCKVNALSLSHICLSSVDMLCMIS*NYFAY 687 +RY ++ + + +S I +SS+D+ C I Y Y Sbjct: 1683 YRYIKYRHILYRYIKYRISSIVISSIDISCYIKYRYIEY 1721 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,585,959 Number of Sequences: 59808 Number of extensions: 304707 Number of successful extensions: 458 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -