BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1266 (721 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81116-3|CAB03303.1| 346|Caenorhabditis elegans Hypothetical pr... 29 3.3 Z81116-2|CAB03302.1| 346|Caenorhabditis elegans Hypothetical pr... 28 5.8 >Z81116-3|CAB03303.1| 346|Caenorhabditis elegans Hypothetical protein T06C12.3 protein. Length = 346 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 84 MTYFNFIISDVIIFFLFRYLCILSFHQGSQCIY*HLNTD-WINF 212 MT++ IIS + I FL+RY+C+ FH + T WI++ Sbjct: 95 MTFYLLIISFIGIQFLYRYICL--FHSAKVRYFDGFGTVLWISY 136 >Z81116-2|CAB03302.1| 346|Caenorhabditis elegans Hypothetical protein T06C12.2 protein. Length = 346 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +3 Query: 84 MTYFNFIISDVIIFFLFRYLCILSFH 161 MT++ IIS + I F++RYLC+ FH Sbjct: 95 MTFYLLIISFIGIQFVYRYLCL--FH 118 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,020,574 Number of Sequences: 27780 Number of extensions: 273533 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1687292480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -