BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1266 (721 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03960.2 68414.m00382 calcium-binding EF hand family protein ... 28 7.2 At1g03960.1 68414.m00381 calcium-binding EF hand family protein ... 28 7.2 >At1g03960.2 68414.m00382 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 389 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 559 INFVFRYFN---FKLVYCKVNALSLSHICLSSVDMLCMIS*NYFAY 687 IN + RYF+ F ++YCK L H C D L N Y Sbjct: 158 INKIIRYFSYEHFYVIYCKFWELDGDHDCFIDKDNLIKYGNNALTY 203 >At1g03960.1 68414.m00381 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand Length = 529 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 559 INFVFRYFN---FKLVYCKVNALSLSHICLSSVDMLCMIS*NYFAY 687 IN + RYF+ F ++YCK L H C D L N Y Sbjct: 298 INKIIRYFSYEHFYVIYCKFWELDGDHDCFIDKDNLIKYGNNALTY 343 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,340,084 Number of Sequences: 28952 Number of extensions: 218156 Number of successful extensions: 372 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -