BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1258 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 32 0.096 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.68 SPCP1E11.08 |||ribosome biogenesis protein Nsa2 |Schizosaccharom... 28 1.6 SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccha... 28 1.6 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 27 2.7 SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 27 3.6 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 6.3 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 26 6.3 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 8.4 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 8.4 SPAC17A5.14 |exo2||exonuclease II Exo2 |Schizosaccharomyces pomb... 25 8.4 SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|... 25 8.4 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 31.9 bits (69), Expect = 0.096 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 432 SGCGRCRVWSMFVRYVRFSELVF*YKRPQKLYIF 533 +GCG+ VW +VR+V F E + LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.68 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 615 ARKIRGRPENAGPDPVRNVRRFSRV 541 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPCP1E11.08 |||ribosome biogenesis protein Nsa2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 260 Score = 27.9 bits (59), Expect = 1.6 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 620 LRLGRSAEGRRTRVRIQSE-T*DDFRECHIKYIQFLRPLILKY*LAKTNITHE 465 +R G+S + R+ ++ D F +KY +F+RP+ L+ K N+TH+ Sbjct: 136 IRTGKSKKNSWKRMITKATFVGDGFTRRPVKYERFIRPMALRQ--KKANVTHK 186 >SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 27.9 bits (59), Expect = 1.6 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = -3 Query: 702 SVPSSELTVERRSYRIVPIAHETKPTRLTARKIRGRPENAGPDPVRNVRRFS 547 SV SS+++ E S + +KP+R TA K + + ++ GP+ R + F+ Sbjct: 332 SVYSSDVSTESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSFA 383 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 27.1 bits (57), Expect = 2.7 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 159 PWNPIEGRYGSEREEHRICGGVRILSADLENSVRDVRGDVAP 284 P+ P+EG Y + ++ HRI R A LE +R V+ P Sbjct: 3 PYEPVEGLYVNAKQYHRILKR-REARAKLEERLRGVQTTKKP 43 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 26.6 bits (56), Expect = 3.6 Identities = 18/80 (22%), Positives = 41/80 (51%), Gaps = 6/80 (7%) Frame = -2 Query: 439 HPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALH-----LGDLLRIWVRTGAT 275 HP ++ R+ P+ N Y+ + + L + L + + +G ++ ++V +G+T Sbjct: 254 HPFYMEQRYIPIGTTNTYTSASHGVLMLSSNGMEVLLRSTYIKYRMIGGIIDLFVYSGST 313 Query: 274 -SPRTSLTEFSRSAESIRTP 218 SP+ ++ ++ +SI TP Sbjct: 314 VSPKYTIQQY---VQSIGTP 330 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.3 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -2 Query: 211 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 74 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 25.8 bits (54), Expect = 6.3 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -1 Query: 629 RHDLRLG-RSAEGRRTRVRIQSET*DDFRECHIKYIQFLRPLILKY*LAKTNITHE 465 + D +LG + A + +V + S+ D +E H+KY+Q L+ LAK +I E Sbjct: 1053 KEDTKLGEKCANIVQLQVDLLSKLADQEKEKHLKYLQSSYKNSLEVQLAKLDIVKE 1108 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 8.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 469 TNIDQTRHRPHPLPVQTRHAPV 404 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 8.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 357 FPYLHYSID*RLFTLETCCGYGYEPARHL 271 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPAC17A5.14 |exo2||exonuclease II Exo2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1328 Score = 25.4 bits (53), Expect = 8.4 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 595 PSADLPSRKSCRFRFVRDRHDS-VRPPFNGQLRTGHRQGESDCL 723 P A + ++S RFR +D HD+ ++ NG+ Q +S+C+ Sbjct: 90 PRAKMNQQRSRRFRTAKDAHDARLKAERNGE-DFPEEQFDSNCI 132 >SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1174 Score = 25.4 bits (53), Expect = 8.4 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -2 Query: 388 YSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLTEFSRSAESIRTPPQM 209 Y + + L +P+L RL A+HLG +I ++ +P +T ++ + TPP + Sbjct: 1093 YKAKSSLLVTLKIPSLIPRLRAIHLGK-GKIVIK---KAPLKQITSKTKEKSTSPTPPSI 1148 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,122,878 Number of Sequences: 5004 Number of extensions: 66644 Number of successful extensions: 204 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 204 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -