BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1258 (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.4 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.2 At5g42370.1 68418.m05159 expressed protein 29 4.2 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 4.2 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.5 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 28 5.5 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 28 5.5 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 7.3 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 7.3 At5g22390.1 68418.m02612 expressed protein 27 9.6 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 453 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 358 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 240 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 106 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 179 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 69 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 42 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 173 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 235 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 137 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = -2 Query: 376 TDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLTEFSRSAESI 227 T LPL L Y L + D RI +G T PR + T F + S+ Sbjct: 289 TSLAAELPLVPLPYLLLPSYSADDPRILYSSGTTGPRNAQTRFQSNQSSV 338 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = -2 Query: 376 TDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLTEFSRSAESI 227 T LPL L Y L + D RI +G T PR + T F + S+ Sbjct: 289 TSLAAELPLVPLPYLLLPSYSADDPRILYSSGTTGPRNAQTRFQSNQSSV 338 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 462 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 343 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 462 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 343 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 114 ERSGKSFLFCLSVRVPWNPIEG 179 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,914,535 Number of Sequences: 28952 Number of extensions: 374690 Number of successful extensions: 1127 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1090 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1127 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -