BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1228 (725 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizo... 27 2.7 SPAC20G8.07c |erg2||C-8 sterol isomerase Erg2 |Schizosaccharomyc... 26 6.3 SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|c... 26 6.3 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 8.3 >SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1513 Score = 27.1 bits (57), Expect = 2.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 265 TINAKDEVSNISRYIDSLNNSRVVLKLNNK 176 T+N +D V N + +IDS+N V L K Sbjct: 747 TVNLRDFVQNANSWIDSVNECLKVASLKRK 776 >SPAC20G8.07c |erg2||C-8 sterol isomerase Erg2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 219 Score = 25.8 bits (54), Expect = 6.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 471 YYYDKYHMLKTFKHSPAKL 527 YY KYH+ ++ PAKL Sbjct: 19 YYIQKYHLRSFYQFDPAKL 37 >SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 871 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 453 IGCKDD--YYYDKYHMLKTFKHSPAKLVSFV 539 +GC + Y +K H LK H P KL+ + Sbjct: 396 VGCISNVNYLIEKVHFLKFIDHMPPKLLGII 426 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 25.4 bits (53), Expect = 8.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -2 Query: 223 IDSLNNSRVVLKLNNK*FAGNVSRSVFVHR 134 ++++NNSR L K F+ +S S F+HR Sbjct: 177 LENVNNSRQDQFLPYKTFSSTISNSDFLHR 206 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,398,916 Number of Sequences: 5004 Number of extensions: 42761 Number of successful extensions: 73 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -