BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1222 (579 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 140 7e-34 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 48 4e-06 SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) 39 0.003 SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 29 2.1 SB_32456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_53092| Best HMM Match : TT_ORF2 (HMM E-Value=3.4) 29 2.7 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 28 6.3 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 28 6.3 SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) 28 6.3 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 28 6.3 SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) 28 6.3 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 28 6.3 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_43755| Best HMM Match : rve (HMM E-Value=5.6e-11) 27 8.4 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 140 bits (339), Expect = 7e-34 Identities = 62/83 (74%), Positives = 74/83 (89%) Frame = -1 Query: 507 VLDCHTAHIACKFAVIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESFQEFP 328 VLDCHTAHIACKF + EK+DRR+GK E NPK IK+GDAA+V ++PSKP+CVE+F EFP Sbjct: 219 VLDCHTAHIACKFDKLLEKIDRRSGKKLEDNPKMIKTGDAAMVEMIPSKPMCVETFTEFP 278 Query: 327 PLGRFAVRDMRQTVAVGVIKAVN 259 PLGRFAVRDM+QTVAVGVIK+V+ Sbjct: 279 PLGRFAVRDMKQTVAVGVIKSVD 301 Score = 35.5 bits (78), Expect = 0.032 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 566 FTAQVIVLNHPGQISNGYT 510 FTAQVIV+NHPG+I GY+ Sbjct: 199 FTAQVIVMNHPGEIHAGYS 217 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 48.4 bits (110), Expect = 4e-06 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -1 Query: 450 VDRRTGKSTEVNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRD 301 +D++TGK + P+ IK AI L +C+E F +F +GRF +RD Sbjct: 496 IDKKTGKKGQTRPRFIKQDQIAIARLETQGVICIEKFSDFQQMGRFTLRD 545 >SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) Length = 80 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = -1 Query: 387 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 271 A V L S+P+CVE ++++ LGRF +R T+A GVI Sbjct: 40 AEVELQTSRPVCVELYKDYKDLGRFMLRYGGNTIAAGVI 78 >SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 30.7 bits (66), Expect = 0.90 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = -1 Query: 528 NLKRLHTVLDCHTAHIACKFAVIKEKVDRRTGKSTEVNPKSIKSGDAAIVNLVPSKP 358 N+ + H + + HIA K V D ++ K+ ++ PK++ SGD ++VP++P Sbjct: 63 NILKFHCI---YLFHIAKKLEV----KDSQSSKNNDLYPKTVPSGDIGTDSVVPNQP 112 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 30.7 bits (66), Expect = 0.90 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +2 Query: 398 DLMDF--GLTSVDLPVRRSTFSL-ITANLQAMWAVWQSK 505 DL +F G+T++ LP ST + NLQ W +WQSK Sbjct: 2456 DLGNFIKGITTIPLPSSSSTPIIDFEVNLQGEWILWQSK 2494 >SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 903 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++VP++P CV SF EF + +RD+ Q Sbjct: 380 MSVVPAQPQCVASFPEFCAVSVSYIRDLSQ 409 >SB_32456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 29.5 bits (63), Expect = 2.1 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +2 Query: 23 FQIYYV*PYINYKIMLHYKPCKKYRKGMSL*PFFPSK-H-LSVNEVSQL 163 +QI+Y+ Y KI +H++ K RK + L FFPS H + +SQL Sbjct: 308 YQIFYILEYTG-KISIHWRYLKITRKYLLLLAFFPSALHPICYGNISQL 355 >SB_53092| Best HMM Match : TT_ORF2 (HMM E-Value=3.4) Length = 598 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 346 VLPGIPTPRSFCCP*HEADSCCRSHQGC 263 +L G T R F C +CCRSH GC Sbjct: 330 LLYGPVTRRLFGCNLSRKKNCCRSHAGC 357 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 465 LQICRQCGQCGNPRLCVTV*DLTRMVKHNDLSCKICS 575 L +C QCGQC +P CV V + +M+ C C+ Sbjct: 767 LIVCSQCGQCFHP-YCVGV-KVNKMILSKGWRCLDCT 801 >SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 904 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 ++++P++P CV SF EF + +RD+ Q Sbjct: 381 MSVMPAQPQCVASFPEFCAVSVSYIRDLLQ 410 >SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 1175 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 385 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 414 >SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) Length = 549 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 389 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 418 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 1044 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1073 >SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 532 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 561 >SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) Length = 1285 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 1111 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1140 >SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) Length = 605 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 184 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 213 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 87 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 116 >SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 381 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 292 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_43755| Best HMM Match : rve (HMM E-Value=5.6e-11) Length = 461 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = -2 Query: 185 VNSTIFHTTAILHSPKGVSKEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISE 24 V++ + A++ P V K+KR SFL Y V +F ++ +V+H ++E Sbjct: 3 VSTDLAKLEAVISWP--VPKKKRELQSFLGLCTYYRKYVKMFADIARVLHRLTE 54 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,380,406 Number of Sequences: 59808 Number of extensions: 384326 Number of successful extensions: 1081 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1080 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -