BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1221 (409 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ... 27 0.85 SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosa... 25 4.5 SPBC29A10.01 |ccr1|SPBC365.17|NADPH-cytochrome p450 reductase |S... 24 7.9 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 24 7.9 SPBC30D10.07c |||biotin-protein ligase |Schizosaccharomyces pomb... 24 7.9 SPAC14C4.05c |mug61||Sad1 interacting factor|Schizosaccharomyces... 24 7.9 >SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 27.5 bits (58), Expect = 0.85 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 189 SICAQSAPSFTDW-KRDASGVRKSRT*LDNFILPERTSSVRLHFRY 55 ++C + + + DW +R +SG+++ T + I ER + HF Y Sbjct: 861 ALCDKMSEIWADWVQRTSSGIQEEDTIPNEMIDEERMLDLEKHFMY 906 >SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 25.0 bits (52), Expect = 4.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 194 VPAFVLRARLHSLIGNETPRECENH 120 VP FV LH G++TP C H Sbjct: 622 VPGFVSSPNLHLAGGSDTPIYCIEH 646 >SPBC29A10.01 |ccr1|SPBC365.17|NADPH-cytochrome p450 reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 24.2 bits (50), Expect = 7.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 280 IDLHVRIATSSIRVSPDFDLTR 215 +DLH+ +A RVSPD T+ Sbjct: 404 VDLHLNLAQVLRRVSPDAPFTK 425 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 24.2 bits (50), Expect = 7.9 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +2 Query: 59 RK*RRTLDVRSGRMKLSSYVRDFR--TPEASRFQSVN 163 RK RRT D + G + ++ DFR P+ R + +N Sbjct: 114 RKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKIN 150 >SPBC30D10.07c |||biotin-protein ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 631 Score = 24.2 bits (50), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 178 STNAGTRKMVNYAWSGRSQGKP*W 249 STN G + NY +GR +G+ W Sbjct: 378 STNTGFTVLGNYQTAGRGRGQNMW 401 >SPAC14C4.05c |mug61||Sad1 interacting factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 844 Score = 24.2 bits (50), Expect = 7.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 1 SMCASH*VL*IFNIKLKGVTKVKANARRSLREDEIIELRS 120 S+C SH + + KLK +T N R E+++LRS Sbjct: 743 SVCVSHCIAKLQKTKLKSLTDFSVNPR-----VEVVQLRS 777 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,630,619 Number of Sequences: 5004 Number of extensions: 31506 Number of successful extensions: 65 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 140222766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -