BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1221 (409 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57580.1 68418.m07194 calmodulin-binding protein similar to c... 27 3.7 At5g05570.1 68418.m00605 transducin family protein / WD-40 repea... 27 3.7 At1g04470.1 68414.m00438 expressed protein EST gb|ATTS5672 comes... 26 8.5 >At5g57580.1 68418.m07194 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 647 Score = 27.5 bits (58), Expect = 3.7 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +3 Query: 189 WDPKDGELCLVRSKSGET-LMEDVAILTCKSIVGTGYRGERLIEPSSSWFRPK 344 W ++ E +V+ +SG+ L+ +T K VGT GE + +SSW R + Sbjct: 160 WTQEEFESHVVKERSGKRPLLTGEVYVTLKEGVGT--LGELVFTDNSSWIRSR 210 >At5g05570.1 68418.m00605 transducin family protein / WD-40 repeat family protein similar to unknown protein (pir||T04661); contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 2 weak)|8683726|gb|AV524198.1|AV524198 Length = 1124 Score = 27.5 bits (58), Expect = 3.7 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 3/28 (10%) Frame = -1 Query: 322 DGSISLSPL-YP--VPTIDLHVRIATSS 248 + IS+SPL YP VPT+D H+ +AT S Sbjct: 414 ENKISVSPLPYPMVVPTMDPHMTVATFS 441 >At1g04470.1 68414.m00438 expressed protein EST gb|ATTS5672 comes from this gene Length = 1035 Score = 26.2 bits (55), Expect = 8.5 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 4/25 (16%) Frame = +3 Query: 237 ETLMEDVAILTCKS----IVGTGYR 299 E LMED +I+TC+S +VGTG + Sbjct: 967 EQLMEDFSIVTCESSGMGLVGTGQK 991 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,590,033 Number of Sequences: 28952 Number of extensions: 171280 Number of successful extensions: 396 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 605614832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -