BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1217 (633 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 2.8 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 4.9 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 22 4.9 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 22 4.9 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 6.5 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/43 (23%), Positives = 21/43 (48%) Frame = +3 Query: 348 YETSNDRLHKLKDTQKVWSNYEYQKEELLSDLDKIENYVVHPG 476 + N+ + + Q S+Y+ ++ L +++ VVHPG Sbjct: 63 FSPCNNTANYKSEAQNQPSSYKQPSSDMADVLLSLKHAVVHPG 105 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 216 SETRPSKSVSYVHLHRGKE 272 S T + + Y HLHR KE Sbjct: 149 SSTPTNSCMEYQHLHRYKE 167 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 216 SETRPSKSVSYVHLHRGKE 272 S T + + Y HLHR KE Sbjct: 149 SSTPTNSCMEYQHLHRYKE 167 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 216 SETRPSKSVSYVHLHRGKE 272 S T + + Y HLHR KE Sbjct: 149 SSTPTNSCMEYQHLHRYKE 167 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 387 TQKVWSNYEYQKEELL 434 TQ+VWS Y + L+ Sbjct: 96 TQRVWSQYNFTNNVLV 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,837 Number of Sequences: 336 Number of extensions: 2529 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -