BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1212 (582 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schiz... 28 0.87 SPBC839.13c |rpl1601||60S ribosomal protein L13/L16|Schizosaccha... 28 0.87 SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces pombe... 27 1.5 SPBC2G2.05 |rpl1603|rpl16c|60S ribosomal protein L13/L16|Schizos... 27 2.0 SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 27 2.0 SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr... 26 3.5 SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch... 25 8.1 >SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 1|||Manual Length = 197 Score = 28.3 bits (60), Expect = 0.87 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 354 LASALEAFRHNPADGSSHHRPLGRVHEPNVRNCVP 250 LA +A R+NP+ G+ H R R+ + VR +P Sbjct: 56 LAYLRKACRYNPSRGAFHFRAPSRIFQKAVRGMLP 90 >SPBC839.13c |rpl1601||60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 2|||Manual Length = 197 Score = 28.3 bits (60), Expect = 0.87 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 354 LASALEAFRHNPADGSSHHRPLGRVHEPNVRNCVP 250 LA +A R+NP+ G+ H R R+ + VR +P Sbjct: 56 LAYLRKACRYNPSRGAFHFRAPSRIFQKAVRGMLP 90 >SPAC3G9.11c |||pyruvate decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 570 Score = 27.5 bits (58), Expect = 1.5 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 Query: 463 TSKPIWIAEIDAIGFFLTRASRLRSP 540 TS+P+++A G+F T AS L++P Sbjct: 163 TSRPVYLAVPSDAGYFYTDASPLKTP 188 >SPBC2G2.05 |rpl1603|rpl16c|60S ribosomal protein L13/L16|Schizosaccharomyces pombe|chr 2|||Manual Length = 197 Score = 27.1 bits (57), Expect = 2.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -1 Query: 354 LASALEAFRHNPADGSSHHRPLGRVHEPNVRNCVP 250 LA +A R+NP+ G+ H R R+ VR +P Sbjct: 56 LAYLRKACRYNPSRGAFHFRAPSRIFTKAVRGMLP 90 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 27.1 bits (57), Expect = 2.0 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 131 LANFVRNDRKSRH-RRIKKQRRYERLAAT 48 LANF+R DR+S H +K++ Y ++A++ Sbjct: 696 LANFIRYDRESVHIPEFQKRKSYSQVASS 724 >SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 697 Score = 26.2 bits (55), Expect = 3.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 48 CGSQAFIATLLFDPSMSALPIIANKIRQAL 137 CGS I +LF S S L + KI Q L Sbjct: 511 CGSSPAIKLILFSKSFSVLQSTSEKIEQLL 540 >SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1362 Score = 25.0 bits (52), Expect = 8.1 Identities = 12/45 (26%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 229 SNTAQYERNAVSDIWFMHSAERPVVR--TTIRGIMPERL*GRSQP 357 S +E N+++ +WF+HS R ++ + GI+ + G + P Sbjct: 766 SKKNNHEINSLTALWFIHSFVRTMIEIICLLIGILASMICGAAYP 810 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,358,922 Number of Sequences: 5004 Number of extensions: 46643 Number of successful extensions: 136 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 250133048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -