BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1212 (582 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 5.2 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 6.9 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 27 9.1 At1g35510.1 68414.m04407 expressed protein contains Pfam PF03138... 27 9.1 At1g14740.1 68414.m01762 expressed protein 27 9.1 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 293 GRWCELPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQCD 424 G W +L +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 342 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 482 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +2 Query: 422 DFTSRVSHSKRETRRRSPFGSRRSMLSVFS*HVHH 526 D + R S SKR+ R SP SRR +S S H H Sbjct: 831 DDSKRKSSSKRKNRSPSPGKSRRRHVSSRSPHSKH 865 >At1g35510.1 68414.m04407 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'growth regulator protein -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 568 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 100 ADIEGSKSNVAMNAWLPQ 47 AD+ GS NV M AW P+ Sbjct: 122 ADVNGSSHNVLMEAWKPR 139 >At1g14740.1 68414.m01762 expressed protein Length = 733 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 305 ELPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSK--QCDFTSRVSHSKRETRRRS 472 EL + LC N+ K SL + GK+++T S K + DF + + ++R++ Sbjct: 69 ELTLSYLCENSGKLAESLGQKGKEVVTFSENSSYDDKWVERDFFNLREMNPNSSKRKA 126 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,617,571 Number of Sequences: 28952 Number of extensions: 258044 Number of successful extensions: 659 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -