BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1210 (718 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0442 - 3369827-3370168,3370608-3372616,3372953-3373277,337... 29 4.9 05_05_0209 - 23282848-23284110 29 4.9 >11_01_0442 - 3369827-3370168,3370608-3372616,3372953-3373277, 3373386-3373415 Length = 901 Score = 28.7 bits (61), Expect = 4.9 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +2 Query: 206 RLEGLRIVPDQRPVLVRKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHRFDAWY-- 379 R EG P ++P+ GASP + K +TD+ T+ AK + ++ + Sbjct: 2 REEGGIASPGEKPI--PNGASPNHSQSPKICSRITDNETQGTATAKSLNEKLVLETVSDD 59 Query: 380 GWKNHCQGSLPDI 418 HCQ PD+ Sbjct: 60 SSTQHCQSPQPDV 72 >05_05_0209 - 23282848-23284110 Length = 420 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -1 Query: 430 LAAANIRQRALAVVLPTVPGIEAVTFVNFLSAFRCLSDVVSQEVGALNVAVFAWT 266 +A A RA+ L ++ I AV F+ + L + ++ ALNVA+ AWT Sbjct: 243 VAVAGHLNRAMLAALVSMATILAVEFLQWWFMLSLLPEAIAV---ALNVAIMAWT 294 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,543,185 Number of Sequences: 37544 Number of extensions: 339439 Number of successful extensions: 803 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -