BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1208 (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0609 + 22710442-22713502,22713596-22713948 29 4.0 11_01_0371 - 2821224-2822036,2822162-2822222,2823755-2824158 29 5.3 02_04_0160 - 20427774-20428217,20428301-20428402,20428503-204285... 28 7.0 10_08_0435 + 17905728-17905901,17906608-17906931,17907205-179073... 28 9.3 09_02_0524 - 10207711-10208154,10208237-10208338,10208439-102085... 28 9.3 04_01_0126 - 1340540-1341376,1341437-1341900,1342105-1342156,134... 28 9.3 >06_03_0609 + 22710442-22713502,22713596-22713948 Length = 1137 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +3 Query: 678 DLSFNFTSLSISNDISNEVNERPLIL 755 DLS+N+ S SIS+++ N VN LI+ Sbjct: 615 DLSYNYLSGSISDEVGNLVNLNKLII 640 >11_01_0371 - 2821224-2822036,2822162-2822222,2823755-2824158 Length = 425 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -1 Query: 206 LKPK*KSLTSLHQQEVRQHFDDIALLHHICDSSSELQHDDVA 81 L+ K K + QQ+ H D+A LH +++ +HD+V+ Sbjct: 263 LQQKLKKARTEEQQQAAFHVSDVATLHAHAAAAAAARHDEVS 304 >02_04_0160 - 20427774-20428217,20428301-20428402,20428503-20428595, 20428675-20428860,20428966-20429213,20429292-20429412, 20430674-20430718,20431086-20431138,20431152-20431173 Length = 437 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 65 LNLAHQQHRRAEAHLKNHRYDEAMQCHQSAAELLVDAMKLTTSTLALE 208 +N Q+ R A + + +A + HQ AA LL + KLT L L+ Sbjct: 334 INEGAQERYRVHAQAEASQ-QQANEAHQQAAALLEEVQKLTVENLQLK 380 >10_08_0435 + 17905728-17905901,17906608-17906931,17907205-17907321, 17908418-17908597,17909064-17909190,17909327-17909440, 17909794-17909909 Length = 383 Score = 27.9 bits (59), Expect = 9.3 Identities = 19/66 (28%), Positives = 28/66 (42%) Frame = +2 Query: 89 RRAEAHLKNHRYDEAMQCHQSAAELLVDAMKLTTSTLALEAITLQHSYHLKQKDLKSTKK 268 RR EAH K YDEA+ + EL + S LE + + +K++ + K Sbjct: 291 RRGEAHEKLEHYDEAIADMKKIIELDPSNEQAKRSLFRLEPLAAEKREKMKEEMIGKLKD 350 Query: 269 SNMSEL 286 S L Sbjct: 351 LGNSVL 356 >09_02_0524 - 10207711-10208154,10208237-10208338,10208439-10208531, 10208612-10208683,10208730-10208798,10208928-10209175, 10209256-10209370 Length = 380 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 65 LNLAHQQHRRAEAHLKNHRYDEAMQCHQSAAELLVDAMKLTTSTLALE 208 +N Q+ R A + + +A + HQ AA LL + KLT L L+ Sbjct: 277 INEGAQERYRVNAQAEAAQ-QQANEAHQQAAALLEEVQKLTVENLQLK 323 >04_01_0126 - 1340540-1341376,1341437-1341900,1342105-1342156, 1342225-1342799,1343596-1343703,1345823-1346155, 1346783-1349306 Length = 1630 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -1 Query: 182 TSLHQQE-VRQHFDDIALLHHICDSSSELQHDDV 84 TS+ E + HFDD LL H+C + D++ Sbjct: 1569 TSIGDSELIDDHFDDNFLLQHLCSEIMDFSGDNI 1602 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,253,201 Number of Sequences: 37544 Number of extensions: 197106 Number of successful extensions: 643 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -