BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1205 (780 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 28 1.7 SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 27 3.0 SPBC25B2.07c |mug164||microtubule-associated protein|Schizosacch... 27 3.0 SPAC1F3.07c |rsc58||RSC complex subunit Rsc58|Schizosaccharomyce... 27 4.0 SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr... 26 5.3 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 9.2 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.9 bits (59), Expect = 1.7 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 64 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 198 Y+C + +S G L SED ++ W K GLI+ F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 27.1 bits (57), Expect = 3.0 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 347 LANFVRNDRKSRH-RRIKKQRRYERLAAT 264 LANF+R DR+S H +K++ Y ++A++ Sbjct: 696 LANFIRYDRESVHIPEFQKRKSYSQVASS 724 >SPBC25B2.07c |mug164||microtubule-associated protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 27.1 bits (57), Expect = 3.0 Identities = 24/129 (18%), Positives = 53/129 (41%), Gaps = 2/129 (1%) Frame = -1 Query: 753 LRSRDARVKKKTDSIDLRDPNGLRRRVSRFEC--ETRLVKSHCLEPPDSRGSTVSISLPD 580 +++ A++ + S+ +R P+ ++ +S R ++ + P S S+ Sbjct: 347 VKNSSAKIVRPGTSLGVRSPSRIQSTLSSRTTTGNVRTKAANIVRPSSSINRRPPSSI-- 404 Query: 579 SARLASALEAFRHNPADGSSHHRPSAECMNQMSETAVPLVLSSITIATTSHQ*GKTNLSH 400 + R S L + + + H RPS+ +++ + + S+ T+ATT L Sbjct: 405 NQRPPSNLRILAPSRSRATIHERPSSSILHRHAHSLTSSSFSTKTLATTKEIQNSPTLVE 464 Query: 399 DGLIPAHVP 373 + H P Sbjct: 465 SSTVVHHDP 473 >SPAC1F3.07c |rsc58||RSC complex subunit Rsc58|Schizosaccharomyces pombe|chr 1|||Manual Length = 403 Score = 26.6 bits (56), Expect = 4.0 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = -1 Query: 216 LYTKGSIGRAFAVPMRTEHLD-QASFCPFAPREVSVLAELALGHLR-YSLTDV-PPQSNS 46 L+ GS G F+ RT LD + + V++L ++ + + Y+L + PP + Sbjct: 125 LFMVGSAGPLFSSTARTSRLDSRLPDGGIIAKPVALLPTPSVANSQEYTLDKLSPPSTAK 184 Query: 45 PPGSVLE 25 PP SV+E Sbjct: 185 PPASVIE 191 >SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 697 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 264 CGSQAFIATLLFDPSMSALPIIANKIRQAL 353 CGS I +LF S S L + KI Q L Sbjct: 511 CGSSPAIKLILFSKSFSVLQSTSEKIEQLL 540 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 9.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 181 SPYAY*TSGSSQLLPFCSTRGF 116 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,322,346 Number of Sequences: 5004 Number of extensions: 69223 Number of successful extensions: 198 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 198 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 377352472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -