BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1204 (733 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80290.1 68414.m09400 glycosyltransferase family protein 47 s... 29 2.4 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 29 4.2 At5g45290.1 68418.m05560 zinc finger (C3HC4-type RING finger) fa... 29 4.2 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 29 4.2 At5g58080.1 68418.m07268 two-component responsive regulator fami... 27 9.7 At4g38480.1 68417.m05438 transducin family protein / WD-40 repea... 27 9.7 >At1g80290.1 68414.m09400 glycosyltransferase family protein 47 similar to exostosin, Homo sapiens [SP|O43909], [SP|Q16394] Length = 329 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = -2 Query: 267 RMRGWNDTRSERVLNE*NSYGLPRDRLKSTTNGSRCITKREVHVFSGR*TFTY 109 R+R W D R+E V GL R++ CI RE H G+ Y Sbjct: 252 RVRDWGDARNEEVEERVRDVGLSSRRVEHRKRRGNCI--REFHRVMGKMPLMY 302 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 158 LLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 27 +LREK RD+++ R EN+ K R+H R R E+ R Sbjct: 97 MLREKKRKERDMEKERDRSKEND--KGVEREHEGDRNRAKEKDR 138 >At5g45290.1 68418.m05560 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 545 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 70 RNVRFVRSFSVGTVRERLTSREDV 141 RNVRF R+ SVG +R+R+ R + Sbjct: 261 RNVRFSRTLSVGRLRDRVLRRSSL 284 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -3 Query: 179 RRTGRDALLREKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERKR 27 R+ +A RE+ + + R E E T+R R+ ARKR ERKR Sbjct: 447 RKEEEEARKREEAKRREEEEAKRR---EEEETERKKREEEEARKREEERKR 494 >At5g58080.1 68418.m07268 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 581 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 210 TSFIRLEHVRTAYRSIHAFGRYH*TNHARVEN 305 +SFI+ H + + S + FG YH T R++N Sbjct: 266 SSFIQQGHHQNSSNSANPFGTYHSTLSPRIQN 297 >At4g38480.1 68417.m05438 transducin family protein / WD-40 repeat family protein contains contains Pfam PF00400: WD domain, G-beta repeat (7 copies, 3 weak);similar to gene PC326 protein - mouse, PIR2:S37694 Length = 471 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +2 Query: 68 DGTFVSCVRSPSARYVNV*RPEKTCTSLLVMHRDPFVVDLRRSRGRPYEFYS 223 D T V+ RY + + TSLL H+ P V L G P+ FY+ Sbjct: 112 DRTIVTSAADKQVRYSKILESGQVETSLLGKHQGP-VHKLAVEPGSPFSFYT 162 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,518,548 Number of Sequences: 28952 Number of extensions: 275666 Number of successful extensions: 660 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -