BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1201 (779 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 2.0 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 6.1 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 8.0 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 25.4 bits (53), Expect = 2.0 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = -2 Query: 760 VVWNCERITISHRKQL*P*FTNSSSVPFAWSKRAKAGLIQMFSTHRD 620 + W+CE+ + + P TN+S F + + G I + ++ D Sbjct: 197 MAWSCEKFKMEEGEDTEPGVTNASKRSFVLAVSFQNGYIYLLKSYDD 243 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 298 RPSGRWCEATIRGIILNA 245 R S RWCE T+ +I +A Sbjct: 363 RESCRWCECTLGDLIADA 380 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.4 bits (48), Expect = 8.0 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = -2 Query: 349 YCSVREEPQFRTFGSCTRPSGR-----WCEATIRGII 254 YC ++ +F F S T P G+ W + + R I+ Sbjct: 395 YCGEEKDKEFLRFISSTAPDGKAKYQEWVQDSCRNIV 431 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 834,765 Number of Sequences: 2352 Number of extensions: 16093 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -