BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1200 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 1.9 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 25 3.3 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.4 bits (53), Expect = 1.9 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -3 Query: 327 FGHLVH-ALGRAAGGAKLPSAGLCLTPLRPKP 235 + L+H A+G GG L G CL R P Sbjct: 936 YSFLMHTAVGHGGGGQSLSGPGSCLEDFRATP 967 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.6 bits (51), Expect = 3.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 304 RPSGRWCEATIRGIMPDA 251 R S RWCE T+ ++ DA Sbjct: 363 RESCRWCECTLGDLIADA 380 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 796,743 Number of Sequences: 2352 Number of extensions: 15634 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -