BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1200 (758 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 54 6e-07 BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. 32 2.6 AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type ... 32 2.6 AY750848-1|AAU81930.1| 1032|Homo sapiens RTN3-A1 protein. 30 7.9 AY427821-1|AAR02474.1| 1013|Homo sapiens reticulon 3-A protein. 30 7.9 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 54.0 bits (124), Expect = 6e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +3 Query: 507 KSNVAMNAWLPQASYPCGNFSGTSC*K 587 KS+VAMNAW PQASYPCGNFS TSC K Sbjct: 11 KSDVAMNAWPPQASYPCGNFSDTSCLK 37 >BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. Length = 322 Score = 31.9 bits (69), Expect = 2.6 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -3 Query: 312 HALGRAAGGAKLPSAGLCLTPLRPKPA*PNPARICSLWSPESRE 181 H A G P++ C TP P P P PA +CS SPE R+ Sbjct: 51 HLQAFAQPGTHFPTSN-C-TPTPPTPVLPGPASLCSPASPELRQ 92 >AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type containing 12 protein. Length = 210 Score = 31.9 bits (69), Expect = 2.6 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -3 Query: 312 HALGRAAGGAKLPSAGLCLTPLRPKPA*PNPARICSLWSPESRE 181 H A G P++ C TP P P P PA +CS SPE R+ Sbjct: 51 HLQAFAQPGTHFPTSN-C-TPTPPTPVLPGPASLCSPASPELRQ 92 >AY750848-1|AAU81930.1| 1032|Homo sapiens RTN3-A1 protein. Length = 1032 Score = 30.3 bits (65), Expect = 7.9 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 6/65 (9%) Frame = -2 Query: 283 EATIRGIMPDASKAEASLAESGKDMLTVEP------RESGGSKQCDFTSRVSHSKRETRR 122 E +GI+ A +++E D T P ESGGS+ D S+ S +ET Sbjct: 660 ETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNG 719 Query: 121 RSPFG 107 P G Sbjct: 720 SEPLG 724 >AY427821-1|AAR02474.1| 1013|Homo sapiens reticulon 3-A protein. Length = 1013 Score = 30.3 bits (65), Expect = 7.9 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 6/65 (9%) Frame = -2 Query: 283 EATIRGIMPDASKAEASLAESGKDMLTVEP------RESGGSKQCDFTSRVSHSKRETRR 122 E +GI+ A +++E D T P ESGGS+ D S+ S +ET Sbjct: 641 ETRDKGIVDSERNAFKAISEKMTDFKTTPPVEVLHENESGGSEIKDIGSKYSEQSKETNG 700 Query: 121 RSPFG 107 P G Sbjct: 701 SEPLG 705 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,337,826 Number of Sequences: 237096 Number of extensions: 2459046 Number of successful extensions: 5220 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5214 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9183116696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -