BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1200 (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17550.1 68415.m02031 expressed protein 31 1.1 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.4 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 29 4.4 >At2g17550.1 68415.m02031 expressed protein Length = 765 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = +3 Query: 54 RSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSAR 233 R+ D + T + + D N LRR+++ E E ++ EP + V + PD Sbjct: 527 RNVDYLSQVSTPDVTVSDENELRRQINELESEVQVRTPVEEEPIQEIETIVDLGNPDKVF 586 Query: 234 LASALEASGI 263 + L ASG+ Sbjct: 587 VRDLLVASGL 596 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -2 Query: 703 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 590 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -3 Query: 276 PSAGLCLTPLRPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 106 PS L RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 159 PSLSPNLQKERPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,601,312 Number of Sequences: 28952 Number of extensions: 343058 Number of successful extensions: 872 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -