BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1199 (578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 3.3 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 21 5.7 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 5.7 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 7.6 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 351 ITIFTSGSIGLSIWMESQTVDRTKVTFHSA 262 + IFT SI + IW S++ R + + SA Sbjct: 218 VLIFTYTSICIEIWQSSESSLRPRSSQKSA 247 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 21.4 bits (43), Expect = 5.7 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 17 SRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAAL 139 SR + SK ++ + L K++KT++PV AL Sbjct: 11 SRQKAPKIVNSKYNSILNIALKNFRLCKKHKTKKPVQILAL 51 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 5.7 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 17 SRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAAL 139 SR + SK ++ + L K++KT++PV AL Sbjct: 11 SRQKAPKIVNSKYNSILNIALKNFRLCKKHKTKKPVQILAL 51 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 160 NMIKDWTESSRIYRSL 113 N++ DW RIY L Sbjct: 157 NVVTDWVNFERIYYKL 172 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,824 Number of Sequences: 336 Number of extensions: 2783 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -