BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1199 (578 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51840| Best HMM Match : WD40 (HMM E-Value=8.3e-07) 142 2e-34 SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) 46 2e-05 SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) 40 0.002 SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.018 SB_5842| Best HMM Match : WD40 (HMM E-Value=6.7e-21) 35 0.042 SB_762| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_38974| Best HMM Match : WD40 (HMM E-Value=1.1e-19) 35 0.042 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 35 0.042 SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_51303| Best HMM Match : WD40 (HMM E-Value=3.5e-40) 33 0.13 SB_30492| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_57808| Best HMM Match : WD40 (HMM E-Value=2.5e-22) 33 0.17 SB_32323| Best HMM Match : WD40 (HMM E-Value=0) 33 0.17 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_23517| Best HMM Match : WD40 (HMM E-Value=0) 33 0.22 SB_21488| Best HMM Match : WD40 (HMM E-Value=3.5e-16) 33 0.22 SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30) 32 0.29 SB_56678| Best HMM Match : WD40 (HMM E-Value=6.4e-22) 32 0.39 SB_8639| Best HMM Match : WD40 (HMM E-Value=1.9e-22) 31 0.51 SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) 31 0.68 SB_56394| Best HMM Match : WD40 (HMM E-Value=6.2e-10) 31 0.90 SB_42895| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_31478| Best HMM Match : Extensin_2 (HMM E-Value=1.3) 31 0.90 SB_40185| Best HMM Match : WD40 (HMM E-Value=0) 30 1.2 SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_22042| Best HMM Match : WD40 (HMM E-Value=6.1e-13) 30 1.2 SB_42598| Best HMM Match : CtaG_Cox11 (HMM E-Value=0) 30 1.6 SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) 29 2.1 SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30) 29 2.1 SB_42181| Best HMM Match : Pyr_redox_2 (HMM E-Value=0.00013) 29 2.1 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_7596| Best HMM Match : WD40 (HMM E-Value=7.1e-15) 29 2.7 SB_42943| Best HMM Match : WD40 (HMM E-Value=0) 29 3.6 SB_39792| Best HMM Match : Usp (HMM E-Value=1.2e-14) 29 3.6 SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_36541| Best HMM Match : WD40 (HMM E-Value=0) 29 3.6 SB_9416| Best HMM Match : WD40 (HMM E-Value=0) 29 3.6 SB_54574| Best HMM Match : WD40 (HMM E-Value=0) 29 3.6 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_36933| Best HMM Match : TNFR_c6 (HMM E-Value=0.93) 28 4.8 SB_34753| Best HMM Match : WD40 (HMM E-Value=5.3e-20) 28 4.8 SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) 27 8.4 SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) 27 8.4 SB_13379| Best HMM Match : WD40 (HMM E-Value=1.3e-39) 27 8.4 >SB_51840| Best HMM Match : WD40 (HMM E-Value=8.3e-07) Length = 242 Score = 142 bits (344), Expect = 2e-34 Identities = 68/90 (75%), Positives = 77/90 (85%) Frame = +2 Query: 5 DMQLSRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAALSPILDHVVLGGGQDA 184 D+Q+ +D TMFVTASKD TAKLFDT+SL LK YKT+RPVNSAALSPI DHVV+GGGQ+A Sbjct: 59 DIQMYKDSTMFVTASKDTTAKLFDTDSLRHLKTYKTDRPVNSAALSPIKDHVVVGGGQEA 118 Query: 185 MEVTTTSTRQGKFDARFFHLVFEGSLAEWK 274 MEVTTTSTR GKFDARFFH+VFE + K Sbjct: 119 MEVTTTSTRVGKFDARFFHVVFEEEIGRVK 148 Score = 48.8 bits (111), Expect = 3e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = +1 Query: 256 EFGRVEGHFGPINSLAFHPDGK 321 E GRV+GHFGPINSLAFHPDG+ Sbjct: 143 EIGRVKGHFGPINSLAFHPDGR 164 >SB_44731| Best HMM Match : WD40 (HMM E-Value=1.1e-11) Length = 256 Score = 46.0 bits (104), Expect = 2e-05 Identities = 25/55 (45%), Positives = 31/55 (56%) Frame = +1 Query: 211 TG*IRCSFLPLSI*REFGRVEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQ 375 TG C LPL+ V GH I++++F PDG ASGG DG VRV +F Q Sbjct: 160 TGAYECGILPLAACSR--SVRGHTDTIHTMSFSPDGTLLASGGMDGAVRVWDFGQ 212 >SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) Length = 1487 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +1 Query: 271 EGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYFDYTF 396 +GH+ +N LA+ PDG A+GG+DG V++ N + TF Sbjct: 1248 QGHYYDMNVLAYSPDGNYIATGGDDGKVKLWNTMTGFCFVTF 1289 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 274 GHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQS 378 GH P++SLAF P SG D VR+ N +S Sbjct: 1377 GHEAPVSSLAFSPSHPVLISGAWDKTVRLWNVFES 1411 >SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +1 Query: 268 VEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFD 372 ++GH +N L F PDG+ SGGEDG +V+ ++ Sbjct: 176 LKGHTDCVNHLRFSPDGRWIISGGEDGAAKVYGWE 210 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 274 GHFGPINSLAFHPDGKSYASGGEDGYVRVH 363 GH I SL FHP G ASG D ++ H Sbjct: 150 GHKSSIRSLDFHPFGDFVASGSLDTNLKGH 179 >SB_48711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 36.3 bits (80), Expect = 0.018 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +1 Query: 271 EGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYFDYTFDYNRE 411 +GH I +LA DGK ASGG+D +R+ + D S +TF +R+ Sbjct: 111 KGHKEQILALAITTDGKYLASGGKDKLIRIWDPDTSKHIHTFKGHRD 157 >SB_5842| Best HMM Match : WD40 (HMM E-Value=6.7e-21) Length = 759 Score = 35.1 bits (77), Expect = 0.042 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 2/88 (2%) Frame = +2 Query: 5 DMQLSRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAALSPILD--HVVLGGGQ 178 D+ + DGT F++A D KL+DT + E L Y ++ +P D H+ + G Sbjct: 138 DVSFNNDGTQFLSAGYDRYVKLWDTETGECLGRYTNKKIPYCVKFNPDEDKQHLFVCGTS 197 Query: 179 DAMEVTTTSTRQGKFDARFFHLVFEGSL 262 D +T R + SL Sbjct: 198 DKKILTVNRVTYSSTSDRIPEFSYASSL 225 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 274 GHFGPINSLAFHPDGKSYASGGEDGYVRV 360 GH + ++F+ DG + S G D YV++ Sbjct: 131 GHSKAVRDVSFNNDGTQFLSAGYDRYVKL 159 >SB_762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.1 bits (77), Expect = 0.042 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = +1 Query: 175 SRCYGSDNHINQTG*IR--CSFLPLSI*REFGRVEGHFGPINSLAFHPDGKSYASGGEDG 348 S Y D H G I + L+ + +EGH PI SL F PD + + +DG Sbjct: 111 SLAYSPDGHYIACGAIDGIINIFDLTTNKLLHTLEGHAMPIRSLTFSPDSQLLITASDDG 170 Query: 349 YVRVHN 366 ++++++ Sbjct: 171 HIKMYD 176 >SB_38974| Best HMM Match : WD40 (HMM E-Value=1.1e-19) Length = 584 Score = 35.1 bits (77), Expect = 0.042 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +1 Query: 259 FGRVEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQ 375 +G ++ +FG + + + PDGK +GGED + V +F + Sbjct: 309 YGVMKSYFGGLTCVCWSPDGKYVVTGGEDDLITVWSFHE 347 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 283 GPINSLAFHPDGKSYASGGEDGYVRVHNFD 372 G IN +F PD K A +DGY+RV +FD Sbjct: 275 GGINEFSFSPDCKHIALVTQDGYLRVFDFD 304 >SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) Length = 1066 Score = 35.1 bits (77), Expect = 0.042 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +1 Query: 268 VEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYFDYTFDYNRE 411 +EGH I+ + FHP+ +G EDG VRV + + + T +Y E Sbjct: 123 LEGHAQNISCVGFHPELPIILTGSEDGTVRVWHANTYRLESTLNYGLE 170 >SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1483 Score = 34.7 bits (76), Expect = 0.055 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +2 Query: 32 MFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAALSP 145 +FVTAS D T +L+D S ++K+ T+ SAA SP Sbjct: 1169 VFVTASDDRTIRLWDIPSKGMVKKTSTDVAARSAAFSP 1206 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 35 FVTASKDHTAKLFDTNSLELLKEYKTER 118 FVT KD L+D N LK+YK + Sbjct: 668 FVTGGKDGMVSLWDENMSRCLKQYKVTK 695 >SB_51303| Best HMM Match : WD40 (HMM E-Value=3.5e-40) Length = 400 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/31 (41%), Positives = 23/31 (74%) Frame = +2 Query: 23 DGTMFVTASKDHTAKLFDTNSLELLKEYKTE 115 D MF+T+S D T K++DTN+L++++ + E Sbjct: 111 DSGMFLTSSVDRTLKVWDTNALQVVETFNFE 141 >SB_30492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 33.5 bits (73), Expect = 0.13 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +1 Query: 286 PINSLAFHPDGKSYASGGEDGYVRV 360 P+N++AFH ++A+GG DG+V + Sbjct: 188 PVNAIAFHNMHNTFATGGSDGFVNI 212 >SB_57808| Best HMM Match : WD40 (HMM E-Value=2.5e-22) Length = 195 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 271 EGHFGPINSLAFHPDGKSYASGGEDGYVRVHNF 369 E H P+ L+F P YAS +DG V++ +F Sbjct: 110 EAHKEPVRGLSFSPTDNKYASCADDGLVKIWDF 142 >SB_32323| Best HMM Match : WD40 (HMM E-Value=0) Length = 611 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 265 RVEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQ 375 R + H GP+ + FH + SGG+D ++V N+ Q Sbjct: 46 RFDEHDGPVRGINFHTVQPLFVSGGDDYKIKVWNYKQ 82 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 268 VEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQS 378 +EGH +N +AFHP SG +D V++ + S Sbjct: 203 LEGHDRGVNWVAFHPTMPLIVSGADDRQVKLWRMNDS 239 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 274 GHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQS 378 GH +N+LA +P G SG D +RV + D S Sbjct: 223 GHLKAVNTLAIYPFGSYIMSGSSDNTIRVWSLDMS 257 >SB_23517| Best HMM Match : WD40 (HMM E-Value=0) Length = 860 Score = 32.7 bits (71), Expect = 0.22 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 3/63 (4%) Frame = +2 Query: 2 TDMQLSRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAALSPILDHV---VLGG 172 T + ++DG + +S D+T +L D ++ ELL E+K + L L+H V+ G Sbjct: 742 TSVTFTQDGQCILVSSLDNTVRLMDKDTGELLNEFKGHQN-KEYKLDSCLNHTDTHVISG 800 Query: 173 GQD 181 +D Sbjct: 801 SED 803 >SB_21488| Best HMM Match : WD40 (HMM E-Value=3.5e-16) Length = 675 Score = 32.7 bits (71), Expect = 0.22 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 277 HFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYFDYTFD 399 H + SLA HPDG++ ASG G+ V D + + D Sbjct: 175 HTDDVKSLAVHPDGRTIASGQVAGHEEVQGEDHGRYIVSVD 215 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 283 GPINSLAFHPDGKSYASGGEDGYVRVHN 366 GP+ +L P+G + GG+DG VR N Sbjct: 286 GPVYALLVLPNGDLLSGGGKDGTVRAWN 313 >SB_17334| Best HMM Match : WD40 (HMM E-Value=3.1e-30) Length = 1292 Score = 32.3 bits (70), Expect = 0.29 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 274 GHFGPINSLAFHPDGKSYASGGEDGYVRVHNF--DQSYFDYTFD 399 GH IN++AF P G ++ +G +D R+ + DQ Y+ D Sbjct: 153 GHESDINAVAFFPSGFAFGTGSDDATCRLFDIRADQELMMYSHD 196 >SB_56678| Best HMM Match : WD40 (HMM E-Value=6.4e-22) Length = 834 Score = 31.9 bits (69), Expect = 0.39 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +2 Query: 8 MQLSRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAALSPILDHVVLGGGQD 181 + S+DG TASKD + + D NS + K L I DH+V G + Sbjct: 96 LAFSKDGLHLFTASKDKSLQAIDMNSGSIAHAIKKAHSCPVNCLKVISDHLVATGDDE 153 >SB_8639| Best HMM Match : WD40 (HMM E-Value=1.9e-22) Length = 442 Score = 31.5 bits (68), Expect = 0.51 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 17 SRDGTMFVTASKDHTAKLFDTNSLELLKE 103 +RDG++F T SKD +L D S +++KE Sbjct: 117 NRDGSLFTTTSKDKKLRLVDPRSGKIVKE 145 >SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 31.5 bits (68), Expect = 0.51 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 283 GPINSLAFHPDGKSYASGGEDGYVRV 360 G +NS+ FHP G A+GG D V++ Sbjct: 113 GFVNSVEFHPSGTCIAAGGTDSTVKI 138 >SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) Length = 208 Score = 31.1 bits (67), Expect = 0.68 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 265 RVEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYF 384 R+ GH IN + F PDG+ AS D V++ N + F Sbjct: 54 RMTGHQALINQVCFSPDGRLIASAAFDKSVKLWNGETGKF 93 >SB_56394| Best HMM Match : WD40 (HMM E-Value=6.2e-10) Length = 183 Score = 30.7 bits (66), Expect = 0.90 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 265 RVEGHFGPINSLAFHPDGKSYASGGEDGYVRV 360 ++ GH +N F P G+ ASGG D +++ Sbjct: 35 QLSGHIADVNCCRFFPSGEVIASGGADFQIKI 66 >SB_42895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 0.90 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = +2 Query: 5 DMQLSRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERP-VNSAALSPI-LDHVVLGGGQ 178 D+ S DG TAS D T L+D + +K K VNS S + +VV G Sbjct: 2 DVHFSTDGNTMFTASTDKTVALWDYETGARMKRLKGHTSFVNSCCPSRRGMQYVVSGSDD 61 Query: 179 DAMEVTTTS 205 ++VT + Sbjct: 62 STIKVTAVA 70 >SB_31478| Best HMM Match : Extensin_2 (HMM E-Value=1.3) Length = 515 Score = 30.7 bits (66), Expect = 0.90 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +2 Query: 17 SRDGTMFVTASKDHTAKLFDTNSLELLKEYK 109 +++G +TAS+DH KLFD +++ L+ ++ Sbjct: 14 NQNGNWLLTASRDHLLKLFDIRAMKELQAFR 44 >SB_40185| Best HMM Match : WD40 (HMM E-Value=0) Length = 503 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 274 GHFGPINSLAFHPDGKSYASGGEDGYVRV 360 GH +N +AFHP+ A+G D VR+ Sbjct: 165 GHVSDVNKVAFHPNCNYIATGSSDRTVRL 193 >SB_26375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 5 DMQLSRDGTMFVTASKDHTAKLFDTNSLELLKEY 106 D S D VTAS D+ A+L++ + E+++EY Sbjct: 246 DCAFSEDSQYLVTASSDNLARLWNVEAGEVVREY 279 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 289 INSLAFHPDGKSYASGGEDGYVRV 360 + ++ FH DGK +GGED R+ Sbjct: 85 VTAVGFHEDGKWMFTGGEDSSARI 108 >SB_22042| Best HMM Match : WD40 (HMM E-Value=6.1e-13) Length = 232 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 8 MQLSRDGTMFVTASKDHTAKLFDTN 82 + + DGT VT SKDHT +++D + Sbjct: 182 LDVCADGTKIVTGSKDHTVRVWDVS 206 >SB_42598| Best HMM Match : CtaG_Cox11 (HMM E-Value=0) Length = 1498 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 295 SLAFHPDGKSYASGGEDGYVRVHNFD 372 ++AFHP S+A G DG VRV + + Sbjct: 15 NIAFHPTNNSFACGFTDGTVRVFDIE 40 >SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) Length = 1597 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 Query: 167 GGGQDAMEVTTTSTRQGKFDARFFHLVFEGS 259 GGG D + V T Q RFF VFEG+ Sbjct: 1453 GGGDDRLFVVTPEAGQIDIPLRFFSAVFEGT 1483 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 301 AFHPDGKSYASGGEDGYVRVHNF 369 AF PDG+ +G DG++ V NF Sbjct: 221 AFSPDGQYLVTGSVDGFIEVWNF 243 >SB_43298| Best HMM Match : WD40 (HMM E-Value=1.7e-30) Length = 685 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 256 EFGRVEGHFGPINSLAFHPDGKSYASGGEDGYVRV 360 + G + H + L + PDGK ASGG D V + Sbjct: 463 KIGTLLNHSQEVCGLKWSPDGKLLASGGNDNVVNI 497 >SB_42181| Best HMM Match : Pyr_redox_2 (HMM E-Value=0.00013) Length = 201 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 Query: 158 VVLGGGQDAMEVTTTSTRQG 217 VVLGGG AM+ TS RQG Sbjct: 20 VVLGGGDTAMDCVRTSVRQG 39 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 17 SRDGTMFVTASKDHTAKLFDTNSLELLK 100 +RDG++F T SKD +L D S +++K Sbjct: 181 NRDGSLFTTTSKDKKLRLVDPRSGKIVK 208 >SB_52576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1649 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 268 VEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFD 372 ++G I +A PD K +GG DG +RV +++ Sbjct: 702 IDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYE 736 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 253 REFGRVEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFD 372 +E + GH I ++A PDG S G+D V+V + + Sbjct: 907 KEVRSLVGHTSDIFAVAVTPDGSKVISSGDDTQVKVWSLE 946 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 268 VEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFD 372 ++GH G + +A DG+ S +D +R+ N + Sbjct: 828 LDGHDGHVRGIAITSDGRRLVSASQDRTLRIWNLE 862 >SB_7596| Best HMM Match : WD40 (HMM E-Value=7.1e-15) Length = 291 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 268 VEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQS 378 ++G + +A PD KS A+GG V V FD + Sbjct: 61 LKGSKSEVTGMAISPDNKSLAAGGHRSAVSVLKFDHT 97 >SB_42943| Best HMM Match : WD40 (HMM E-Value=0) Length = 273 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 283 GPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYFDYT 393 G +N + PDG ASGG+DG + + + YT Sbjct: 202 GYLNCVTVSPDGSLCASGGKDGQAMLWDLNDGKHLYT 238 >SB_39792| Best HMM Match : Usp (HMM E-Value=1.2e-14) Length = 271 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 418 LTTPYCNRKCSQSKIDQSYEHAHNHLHLRKHRTFHLDGKP 299 + P CN + +++ + Q E N LR+ R FH P Sbjct: 225 IIVPPCNCQVAKTALQQKTEEGRNANRLRRFRDFHYTALP 264 >SB_36694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1803 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 5 DMQLSRDGTMFVTASKDHTAKLFDTNSLELLKE 103 D+ S DG + + S+D T +++D + E LK+ Sbjct: 1463 DVAFSSDGALLTSGSRDRTVRVWDCAAAEKLKK 1495 >SB_36541| Best HMM Match : WD40 (HMM E-Value=0) Length = 1070 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 253 REFGRVEGHFGPINSLAFHPDGKSYASGGEDGYVRV 360 R+ ++GH G I LA DGK SG +D ++V Sbjct: 411 RDCVSLKGHGGLIKCLAAMHDGKRIVSGAKDNNIKV 446 >SB_9416| Best HMM Match : WD40 (HMM E-Value=0) Length = 700 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 265 RVEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQ 375 +++GH + ++ DG+ SG DG VR+ + Q Sbjct: 206 KLKGHMDNVKAVVIDSDGQQCLSGSSDGTVRLWSLGQ 242 >SB_54574| Best HMM Match : WD40 (HMM E-Value=0) Length = 1050 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 289 INSLAFHPDGKSYASGGEDGYVRVHNFDQSYFDYT 393 I+S+ F P G++ A G E G + V N ++ YT Sbjct: 845 IHSVTFSPRGEAIAVGCESGTISVFNLQEARVMYT 879 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/29 (41%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +1 Query: 277 HFGPINSLAFHPDGKSY-ASGGEDGYVRV 360 H GP+ +L +HP+ +++ A+GG D V+V Sbjct: 420 HNGPVFTLDWHPEDRNWIATGGRDKCVKV 448 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 298 LAFHPDGKSYASGGEDGYVR 357 L FH GK Y SGG DG VR Sbjct: 560 LDFHFSGKIYVSGGFDGTVR 579 >SB_36933| Best HMM Match : TNFR_c6 (HMM E-Value=0.93) Length = 524 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 403 CNRKCSQSKIDQSYEHAHNHLHLRKHRTFHLDGKPNC 293 CNR S SK + + N + T HLDG NC Sbjct: 267 CNRYESLSKASEECKEWVNSEQFKLWETSHLDGSANC 303 >SB_34753| Best HMM Match : WD40 (HMM E-Value=5.3e-20) Length = 645 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 289 INSLAFHPDGKSYASGGEDGYVRVH 363 I+ + F PDGK A G D YV ++ Sbjct: 231 ISDIKFSPDGKFLAVGSHDNYVDIY 255 >SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 459 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 277 HFGPINSLAFHPDGKSYASGGEDGYVRV 360 H P+ +++F PDG+ ASG D V + Sbjct: 332 HHEPVYTISFSPDGRYLASGSFDKRVHI 359 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 253 REFGRVEGHFGPINSLAFHPDGKSYASGGEDGYVRV 360 R+F ++GH + L F +GK AS +D VR+ Sbjct: 92 RQFAALKGHTSEVLDLDFSLNGKLLASTSQDRTVRL 127 >SB_45927| Best HMM Match : WD40 (HMM E-Value=9e-18) Length = 1764 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 274 GHFGPINSLAFHPDGKSYASGGEDGYVRV 360 GH + LA DG SG EDG V+V Sbjct: 1057 GHSKGVYGLAVTADGSCVVSGSEDGSVKV 1085 >SB_34659| Best HMM Match : WD40 (HMM E-Value=1.1e-34) Length = 292 Score = 27.5 bits (58), Expect = 8.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 265 RVEGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQS 378 R+ GH + L + PD + ASGG D + V N S Sbjct: 141 RLVGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNLSGS 178 >SB_13379| Best HMM Match : WD40 (HMM E-Value=1.3e-39) Length = 574 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 292 NSLAFHPDGKSYASGGEDGYVRV 360 N++ DGK++ SG +DG +RV Sbjct: 222 NTVDIQKDGKAFVSGWDDGKIRV 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,832,912 Number of Sequences: 59808 Number of extensions: 332352 Number of successful extensions: 1048 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1041 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -