BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1199 (578 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 2.9 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 3.8 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 22 5.0 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 6.7 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.6 bits (46), Expect = 2.9 Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 363 MNTHITIFTSGSIGLSIWM---ESQTVDRTKVTFHSAKLPSNTKWKK 232 +N I F S L+ W RT + + KLP+ WKK Sbjct: 354 INPFIYAFYSADFRLAFWRLTCRKCFKSRTNLDPSNRKLPAPANWKK 400 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 Query: 282 KVTFHSAKLPSNTKW 238 KVTFH +P++ W Sbjct: 99 KVTFHEMSIPNHYLW 113 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 402 VIESVVKVRLIKVMNTHITIFTSGSIGLS 316 VI +K L +V+N H TS IG++ Sbjct: 48 VIGKKIKELLPEVLNNHCNRCTSRQIGIA 76 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 366 VMNTHITIFTSGSIGLSIWMESQTVDRTKV 277 V + +F + LS W E Q++DR + Sbjct: 310 VSKNGVLLFGLANNTLSCWNEHQSLDRQNI 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,547 Number of Sequences: 438 Number of extensions: 3250 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -