BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1195 (729 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18589| Best HMM Match : Filament (HMM E-Value=0.024) 29 3.9 >SB_18589| Best HMM Match : Filament (HMM E-Value=0.024) Length = 324 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 81 TVIRKVKPSWLLKC*AFNLRVDKEL*YTKHVCSRVELL 194 T++ +K LKC + ++V++EL TK CSR+E + Sbjct: 55 TMVDTIKIVIGLKCRPYAIQVEEELAKTKEQCSRLETM 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,423,613 Number of Sequences: 59808 Number of extensions: 393446 Number of successful extensions: 693 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -