Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm1195
         (729 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.    24   1.7  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    22   5.2  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    22   5.2  

>DQ011226-1|AAY63895.1|  471|Apis mellifera Rh-like protein protein.
          Length = 471

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)
 Frame = -3

Query: 718 LGHMLGFPSLF-WSY*TSTVQKFVNKHSTIPLSTLHG 611
           +G + G  S+  + Y T  +QK +  H T  +  LHG
Sbjct: 300 VGALAGLLSVLGYKYITPLIQKHLKIHDTCGVHNLHG 336


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 242 DGWMTYGPP 268
           D WMTY PP
Sbjct: 328 DNWMTYMPP 336


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +2

Query: 242 DGWMTYGPP 268
           D WMTY PP
Sbjct: 328 DNWMTYMPP 336


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,247
Number of Sequences: 438
Number of extensions: 3786
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22657590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)