BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1192 (565 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0090 + 17228253-17228403,17229062-17229129,17229238-172309... 31 0.63 06_01_0350 + 2534422-2535615 31 0.84 12_01_0796 + 7292523-7292783,7292963-7293018,7295274-7295331,729... 29 1.9 05_06_0098 + 25560158-25560925 29 3.4 04_03_0732 + 19095320-19095827,19095848-19096621,19096863-190969... 29 3.4 12_02_0854 + 23697826-23698033,23699111-23699276,23699430-236994... 28 5.9 05_04_0162 + 18645459-18645827,18645934-18646149,18646224-186462... 28 5.9 01_04_0113 - 16133794-16134933,16135030-16135611,16135698-16135853 28 5.9 06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357,199... 27 7.8 >03_04_0090 + 17228253-17228403,17229062-17229129,17229238-17230902, 17231002-17231143,17231648-17232399 Length = 925 Score = 31.1 bits (67), Expect = 0.63 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 6/33 (18%) Frame = -1 Query: 388 TNIDQTRH------RPHPLPVQTRHAPVLRANP 308 T IDQ H + H +PVQ H+PVL+ NP Sbjct: 324 TQIDQPSHCQRIKNQDHSVPVQKNHSPVLKTNP 356 >06_01_0350 + 2534422-2535615 Length = 397 Score = 30.7 bits (66), Expect = 0.84 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 83 PWNSNAQAEKKTLPGPLGGVFRP 15 PW S+A+ E+K LP PL +F P Sbjct: 42 PWRSSARLERKLLPPPLPWLFLP 64 >12_01_0796 + 7292523-7292783,7292963-7293018,7295274-7295331, 7295777-7295843,7296461-7296516,7296638-7296691, 7296836-7296961 Length = 225 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 358 HPLPVQTRHAPVLRANPYSEVTDPICRLPL 269 H L + RH P L+A P S + C+LPL Sbjct: 107 HSLIIPKRHFPSLQATPPSVIAAICCKLPL 136 >05_06_0098 + 25560158-25560925 Length = 255 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -1 Query: 367 HRPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLF 257 HRP P P + P L +P + V I P PT F Sbjct: 31 HRPPPPPPSSSSQPALPPSPRTVVPRTIDTTPFPTTF 67 >04_03_0732 + 19095320-19095827,19095848-19096621,19096863-19096906, 19097191-19097250 Length = 461 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 364 RPHPLPVQTRHAPVLRANPYSEVTDP 287 RP+PL V +RHA VL + V DP Sbjct: 133 RPNPLDVVSRHAGVLSRGDHCLVVDP 158 >12_02_0854 + 23697826-23698033,23699111-23699276,23699430-23699466, 23699531-23700145 Length = 341 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -2 Query: 390 ARTSTRPGTGRIRFPSKPDTPRSSE 316 A TST PG GR R PS P TP S+ Sbjct: 16 AATSTDPGRGRKRPPS-PSTPTPSD 39 >05_04_0162 + 18645459-18645827,18645934-18646149,18646224-18646278, 18646545-18646672,18647134-18647217,18648742-18648867, 18648949-18649086 Length = 371 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 378 TRPGTGRIRFPSKPDTPRSSEPILIPKLR 292 TRP TG+ P K D RS + I KLR Sbjct: 108 TRPRTGKAALPLKRDRTRSKRFLEIQKLR 136 >01_04_0113 - 16133794-16134933,16135030-16135611,16135698-16135853 Length = 625 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 220 GYGYEPARHLHVHPSPEFSRSAES-IRTPPQMRCSSRSEPYLPSI 89 G+ P+ H P P+ S R PP R S RSE P + Sbjct: 26 GFDVTPSPHAEPSPRPQLRHDNPSRSRVPPLERVSRRSEVVFPPL 70 >06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357, 1990434-1990621,1990711-1990835,1990988-1991039, 1991585-1991874,1992229-1992307,1992527-1992657 Length = 464 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 352 LPVQTRHAPVLRANPYSEVTDPICRLPLPTLF 257 +P Q + A + A+P + V C LP P+LF Sbjct: 292 IPYQFQEATSILASPLAHVPASSCPLPAPSLF 323 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,051,921 Number of Sequences: 37544 Number of extensions: 384280 Number of successful extensions: 1384 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1384 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -