BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1192 (565 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 32 0.30 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 32 0.30 At2g45560.1 68415.m05665 cytochrome P450 family protein 30 0.93 At1g76965.1 68414.m08961 glycine-rich protein 30 1.2 At3g06360.1 68416.m00734 arabinogalactan-protein (AGP27) 29 2.1 At1g18700.1 68414.m02333 DNAJ heat shock N-terminal domain-conta... 29 2.1 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 2.8 At2g19150.1 68415.m02235 pectinesterase family protein contains ... 29 2.8 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 3.7 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 3.7 At3g25250.1 68416.m03154 protein kinase family protein contains ... 28 5.0 At5g22390.1 68418.m02612 expressed protein 27 6.5 At1g66880.1 68414.m07601 serine/threonine protein kinase family ... 27 6.5 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 27 6.5 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 27 8.7 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 27 8.7 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 31.9 bits (69), Expect = 0.30 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = -2 Query: 438 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 262 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 Query: 261 YSTTRGSSP 235 T G+SP Sbjct: 409 --ITPGASP 415 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 31.9 bits (69), Expect = 0.30 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = -2 Query: 438 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 262 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 Query: 261 YSTTRGSSP 235 T G+SP Sbjct: 409 --ITPGASP 415 >At2g45560.1 68415.m05665 cytochrome P450 family protein Length = 512 Score = 30.3 bits (65), Expect = 0.93 Identities = 20/56 (35%), Positives = 26/56 (46%) Frame = +1 Query: 343 GREADAAGAGSGRCSCVMFVLAS*YFNIMRPQKLYIFNMTLAKIVLRFGLDPDPRF 510 GR+ + G+GR C LA ++M LY F+ L K VL LD D F Sbjct: 435 GRDYELTPFGAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMDETF 490 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = -2 Query: 372 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSTTRGSSPWRPAADM 214 PG + FP KP+ P P +P+L + F D L +T + P ++ Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGDDRRLLENTVCEHMRYNPTPEL 145 >At3g06360.1 68416.m00734 arabinogalactan-protein (AGP27) Length = 125 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 493 DPDPRFRPSADLPSRKVVSVSFRA 564 DPDP F PSA P+ + S+S +A Sbjct: 77 DPDPAFAPSASPPASSLASLSSQA 100 >At1g18700.1 68414.m02333 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q9QYI8 DnaJ homolog subfamily B member 7 Mus musculus; contains Pfam profile PF00226 DnaJ domain Length = 700 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 428 CGLKNCIYLI*HSRKSSYVSDWIRTRVSGLPRIF 529 C +C+ + ++DW T V GLPR+F Sbjct: 234 CKTADCLIRFEGELSADAITDWFATTVLGLPRVF 267 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 159 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 25 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At2g19150.1 68415.m02235 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 339 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 129 ICGGVRILSADLENSGEGCTWRCRAGSYPYPQQV 230 I GG+ + ++ EGCT + R G YP P +V Sbjct: 185 ISGGIDFIFGGAQSIFEGCTLKLRVGIYP-PNEV 217 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 504 RVRIQSET*DDFRECHIKYIQFLRPH 427 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 154 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 56 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At3g25250.1 68416.m03154 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 421 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/54 (29%), Positives = 21/54 (38%) Frame = -1 Query: 310 PYSEVTDPICRLPLPTLFYD*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 149 P + P P PT+ RLF + C G P + VH S + S S Sbjct: 176 PRTPQPSPSLSKPSPTMKRKKRLFRFTSFCNSGISPQESISVHSSSTLAVSDSS 229 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 33 ERSGKSFLFCLSVRVPWNPIEG 98 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At1g66880.1 68414.m07601 serine/threonine protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 1296 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 433 PQKLYIFNMTLAKIVLRFGLDPDPRFRPSADLPSRKVVSVS 555 P K++ + T + + + DP +R S P R +VSVS Sbjct: 493 PSKIFEISSTYKSLTVFYLCDPKVSYRSSYTCPGRGLVSVS 533 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 196 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 107 H H +P+ S S S+RTPP R +SR E Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 412 NSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 287 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 412 NSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 287 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,130,831 Number of Sequences: 28952 Number of extensions: 285305 Number of successful extensions: 872 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -