BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1190 (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 5.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.6 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 7.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 7.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.8 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 9.8 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 23 9.8 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 708 PPGSVLEP-DHAGVLNGD 658 PPGS+L+P D A V+ G+ Sbjct: 1092 PPGSILDPSDGAAVVGGN 1109 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 5.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 329 DEAFGYLKRVIVTPAVYPRLLEFLHL 252 D +F L RV TPA P +EFL L Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFL 658 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 729 VPPQSNSPPGSVLEPD 682 +PP SNS P S PD Sbjct: 868 MPPSSNSSPSSYPSPD 883 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 137 PLNGGRTESCRSRTKRNR 84 P +GGR SCRS R R Sbjct: 262 PRSGGRWPSCRSPPARRR 279 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 9.8 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 316 PNASSSN**RA*MD*RDSHCPYLLSSETTAKGTGLGESAGKEDPVELDSS 465 P AS S R + +SH P ++ T LG SAG E+D++ Sbjct: 2416 PVASLSEGFRKALQIYNSHVPDIVGVLNNHFMTALGRSAGDVQSYEIDAN 2465 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = -2 Query: 549 NESSGFSATIARNDSHLCYTSHVSLQCQT 463 NE++ + RND++ + + + +QC T Sbjct: 141 NETTCMNYECLRNDANETFINSIGIQCNT 169 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 153 HGQGESDCLI-KTKHCDGPRGC*RNVISAQC 242 +GQ ++D L+ + ++ DGP C R+ QC Sbjct: 95 YGQEKADELVARCRNNDGPDACERSFRLLQC 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,084 Number of Sequences: 2352 Number of extensions: 18097 Number of successful extensions: 43 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -