BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1190 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 3.0 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.2 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 21 9.1 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 21 9.1 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.1 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +3 Query: 159 QGESDCLIKTKHCDGPRGC*RNVISAQCSECQVKKFK 269 +G+ + + C G +V +C+EC + KFK Sbjct: 235 KGDGKWYLPSGGCHCKPGYQADVEKQECTECPIGKFK 271 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 522 SSLKNHYFHCFITYSVGRK 578 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 122 RTESCRSRTKRNRHD 78 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 122 RTESCRSRTKRNRHD 78 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 122 RTESCRSRTKRNRHD 78 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 122 RTESCRSRTKRNRHD 78 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 122 RTESCRSRTKRNRHD 78 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 122 RTESCRSRTKRNRHD 78 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 122 RTESCRSRTKRNRHD 78 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 516 ARSSLKNHYFHCFI 557 A L+N Y+ CFI Sbjct: 37 ANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 516 ARSSLKNHYFHCFI 557 A L+N Y+ CFI Sbjct: 37 ANDRLRNQYYDCFI 50 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 497 ATPLMSPYNARLESSSTGSSFP 432 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,351 Number of Sequences: 438 Number of extensions: 4939 Number of successful extensions: 17 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -