BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1189 (716 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 33 0.002 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 23 3.3 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 23 3.3 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 23 3.3 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 22 4.3 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 33.1 bits (72), Expect = 0.002 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +1 Query: 130 ESKYRELRDKNNEASKRSRMNRKLKELQMEQLAIDLEERN 249 + Y E R KNNEA+KRSR R+ KE ++ LE N Sbjct: 135 DPSYWEKRRKNNEAAKRSRDARRAKEDEIAIRCAFLEREN 174 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 106 FHQCCMWMIVCCLVSWGVGL 47 FH + C++SW VG+ Sbjct: 171 FHNLTLITYSLCVISWAVGI 190 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 86 PHAALMKIHQIFPLKN 133 P ALM+I IFP+KN Sbjct: 66 PIYALMRIVGIFPIKN 81 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 Query: 106 FHQCCMWMIVCCLVSWGVGL 47 FH + C++SW VG+ Sbjct: 171 FHNLTLITYSLCVISWAVGI 190 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 22.2 bits (45), Expect = 4.3 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 127 QESKYRELRDKNNEASKRSRMNRKLKELQMEQLAID 234 QE Y+ELRD ++ + N L+ +E++ ++ Sbjct: 19 QEKVYQELRDIFQDSDRPITFNDTLQMKYLERVLLE 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,135 Number of Sequences: 336 Number of extensions: 3528 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -