BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1187 (623 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 9e-12 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 63 2e-10 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) 47 1e-05 SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) 32 0.43 SB_26758| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-40) 29 3.1 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 29 3.1 SB_36343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_2980| Best HMM Match : DUF814 (HMM E-Value=2.10195e-44) 29 4.1 SB_1261| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_40420| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 28 7.1 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 28 7.1 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 28 7.1 SB_53612| Best HMM Match : SRCR (HMM E-Value=0) 28 7.1 SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4) 28 7.1 SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 28 7.1 SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) 28 7.1 SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6) 28 7.1 SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8) 28 7.1 SB_36043| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_52459| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_46457| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.4 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 67.3 bits (157), Expect = 9e-12 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 375 SPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSL 256 +PTY+TPLMS + RLESSSTGSSFPAD KPVPLAVVSL Sbjct: 88 TPTYSTPLMSFHRVRLESSSTGSSFPADCAKPVPLAVVSL 127 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = -2 Query: 532 NGDERFRHSPLCTLGTKHGAPADIIDGAPLPPNRVSNETMKVVVFQRR 389 + DE RH +C T + P G+ LP +R+S +T++VVVF RR Sbjct: 41 DSDECLRHGSVCKRETLN--PEREPCGS-LPLHRISKKTIRVVVFHRR 85 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 116 HSEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 12 ++EHWAEITLRQH PSQCFVLI+QSDSP CQF Sbjct: 48 NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 51.2 bits (117), Expect = 7e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +1 Query: 187 MPRHLISDAHEWINEIPTVPI 249 MPRHLISDAHEWINEIPTVPI Sbjct: 1 MPRHLISDAHEWINEIPTVPI 21 >SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) Length = 167 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +2 Query: 104 SALNVNVKKFKQARVNGGSNYDSL 175 +ALNV VKKF QARVNGGSNYDSL Sbjct: 28 AALNVKVKKFNQARVNGGSNYDSL 51 >SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +2 Query: 107 ALNVNVKKFKQARVNGGSNYDSL 175 ALNV VKKF QARVNG SNYDSL Sbjct: 2 ALNVKVKKFNQARVNGWSNYDSL 24 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 101 PSALNVNVKKFKQARVNGGSNYDS 172 PSALNV VKKF QARVNGG +S Sbjct: 31 PSALNVKVKKFNQARVNGGDPLES 54 >SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) Length = 108 Score = 31.9 bits (69), Expect = 0.43 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -3 Query: 621 RTLRYS*QMYRPSQTPRLAVSSNRI 547 +T Y +M RPSQTP L VSS RI Sbjct: 62 QTREYGQKMCRPSQTPNLTVSSTRI 86 >SB_26758| Best HMM Match : 7tm_1 (HMM E-Value=3.5e-40) Length = 1413 Score = 29.1 bits (62), Expect = 3.1 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = -3 Query: 615 LRYS*QMYRPSQTPRLAVSSNRI----TREF*TATSVSATHHSARLERNTVRPPILSTAH 448 LRY Q+ S P +A SSNR+ +E +SV+ S L +++ RP ++S +H Sbjct: 446 LRYMCQVVNGSSLPTIATSSNRVGTSSLKETPVLSSVTIATSSYSLLKSS-RPAVISPSH 504 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 31 ESDCLIKTKHCDGPRGC*RNVISAQCSE 114 E DC+ +KHCDG C C E Sbjct: 73 EGDCIPLSKHCDGTWDCQHGTDEMDCQE 100 >SB_36343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -3 Query: 378 RSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLVVD 247 R PT P + Y +S TG +F AD P+ VP+ VS ++ Sbjct: 117 RRPTDDPPPLPDYVMVRFTSYTGPAFIADDPQVVPIVPVSRSIE 160 >SB_2980| Best HMM Match : DUF814 (HMM E-Value=2.10195e-44) Length = 950 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 550 DHAGVLNGDERFRHSPLCTLGTKHGAPADIIDGAPLPPNRVSNE 419 ++ G + E R T G + G AD+IDGA PP + E Sbjct: 760 NNTGRVTNSEPIRTIGETTNGKEAGNAADVIDGAGAPPEGLEQE 803 >SB_1261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = -2 Query: 553 PDHAGVLNGDERFRHSPLCTLGTKHGAPADIIDGAPLPPNRVSNETMKVVVFQ 395 P H +G RH P TL A +ID AP PP+ + +F+ Sbjct: 38 PSHPKGRSGRSGLRHPPTRTLPYLQPARHRVIDEAPPPPSHPQKRKRGLNIFE 90 >SB_40420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 596 CTALVKLPAWQCPRTGS 546 C A KLP WQC R GS Sbjct: 2 CAAPAKLPTWQCLRHGS 18 >SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 732 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 374 VFGRDFDIITDHKPLLSLFH 393 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 1317 VFGRDFDIITDHKPLLSLFH 1336 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 79 VFGRDFDIITDHKPLLSLFH 98 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627 >SB_53612| Best HMM Match : SRCR (HMM E-Value=0) Length = 409 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 384 AKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 274 A + T ATP SP R +++ SS SP P P Sbjct: 366 ASSASTPATPDSSPKRKRTRQANSASSSQPSSPHPAP 402 >SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4) Length = 300 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 259 VFGRDFDIITDHKPLLSLFH 278 >SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1089 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 568 VFGRDFDIITDHKPLLSLFH 587 >SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 429 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 347 VFGRDFDIITDHKPLLSLFH 366 >SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186 >SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) Length = 1544 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 773 VFGRDFDIITDHKPLLSLFH 792 >SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6) Length = 309 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186 >SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627 >SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8) Length = 391 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 364 ISGRSFRAIVAEKPLLSLFH 423 + GR F I KPLLSLFH Sbjct: 241 VFGRDFDIITDHKPLLSLFH 260 >SB_36043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 502 LCTLGTKHGAPADIIDGAPLPPN 434 LCT T HG P + P PPN Sbjct: 4 LCTQATLHGGPLYCLPWVPEPPN 26 >SB_52459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 555 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 541 PRDPVRGHCQAGSLTRAVHLSRITQCP 621 P V+ HC A +TR VH I + P Sbjct: 185 PMGQVKLHCTANGITRKVHFQIIKEAP 211 >SB_46457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 541 PRDPVRGHCQAGSLTRAVHLSRITQCP 621 P V+ HC A +TR VH I + P Sbjct: 213 PMGQVKLHCTANGITRKVHFQIIKEAP 239 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 588 PSQTPRLAVSSNRITREF*TATSVSATHHSARLERNTVR 472 PS+ P L + S RI TA+SV +H+A R +R Sbjct: 2994 PSRLPALGMRSRRIRNNQITASSVWDRYHAANRARLHIR 3032 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 588 PSQTPRLAVSSNRITREF*TATSVSATHHSARLERNTVR 472 PS+ P L + S RI TA+SV +H+A R +R Sbjct: 3566 PSRLPALGMRSRRIRNNQITASSVWDRYHAANRARLHIR 3604 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,517,356 Number of Sequences: 59808 Number of extensions: 399312 Number of successful extensions: 1029 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1024 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -