BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1185 (583 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.018 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.042 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.097 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.39 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.39 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 6.4 SB_47600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 413 DVVAVSQAPSPESNPDSPLPVTTM 342 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 6e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 404 AVSQAPSPESNPDSPLPVTTM 342 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.018 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +2 Query: 2 VICLSQRLSHACLSASRIKAIPRMA 76 VICLSQRLSHACLS S RMA Sbjct: 137 VICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +2 Query: 2 VICLSQRLSHACLSASRIKAIPRMA 76 VICLSQRLSHACLS S RMA Sbjct: 113 VICLSQRLSHACLSISTRTVKLRMA 137 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.042 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 403 PFLRLPLRNRTLIPRYP 353 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 33.9 bits (74), Expect = 0.097 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = +2 Query: 521 LNILTRNNWRASLVPAAAVIP 583 ++++ R +WRASLVPAAAVIP Sbjct: 56 MHLVIRIHWRASLVPAAAVIP 76 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 3 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 137 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 536 RNNWRASLVPAAAVIP 583 R +WRASLVPAAAVIP Sbjct: 14 RIHWRASLVPAAAVIP 29 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 3 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 137 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 6.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 422 PSLDVVAVSQAPSPESNPDSPLP 354 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_47600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 27.5 bits (58), Expect = 8.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 250 WILLQIAWSSTGDASFKCLP 309 W +Q+AW + G+ FK +P Sbjct: 293 WSRVQVAWKTVGEEKFKIIP 312 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,093,462 Number of Sequences: 59808 Number of extensions: 408501 Number of successful extensions: 1075 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1074 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -