BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1184 (342 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g14210.1 68416.m01796 myrosinase-associated protein, putative... 25 10.0 >At3g14210.1 68416.m01796 myrosinase-associated protein, putative similar to GB:CAA71238 from [Brassica napus]; contains Pfam profile:PF00657 Lipase/Acylhydrolase with GDSL-like motif Length = 392 Score = 25.4 bits (53), Expect = 10.0 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 201 LNFRQILFKNIDIGWREIYRGKGIFNILKNYSVFYNIYQIN 79 LN + + FKN+ W + Y K +F I + N + N Sbjct: 131 LNQQVVKFKNMKSNWNDSYIEKSLFMIYIGTEDYLNFTKAN 171 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,265,976 Number of Sequences: 28952 Number of extensions: 39942 Number of successful extensions: 83 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 409426656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -