BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1183 (771 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0256 - 42328795-42329172,42330245-42330379,42330783-423310... 32 0.44 04_04_1571 + 34504087-34504421,34505002-34505731,34506091-345120... 28 7.2 01_06_0192 + 27347369-27348826,27349124-27349264,27349350-273510... 28 9.5 >01_07_0256 - 42328795-42329172,42330245-42330379,42330783-42331033, 42331290-42331341,42331619-42331647,42331812-42332105, 42332229-42332378,42333915-42334405,42334513-42334613, 42334941-42335037,42335882-42335950,42336036-42336122, 42336423-42336494,42336795-42336863,42337784-42337858, 42338230-42338301,42338378-42338449,42338533-42338676, 42339106-42339177,42339294-42339365,42339804-42339954, 42340204-42340297 Length = 1008 Score = 32.3 bits (70), Expect = 0.44 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +3 Query: 435 LLNKINQKSLL-LFQICPQNDKQVIVIIIRSYFGLDLTKNQAQPN 566 LL++++ ++L+ L C + D+QV+ IR YFG + + PN Sbjct: 702 LLSRLHHRNLVSLLGYCDEEDEQVVPAAIRFYFGEQMLVYEFMPN 746 >04_04_1571 + 34504087-34504421,34505002-34505731,34506091-34512077, 34512493-34513964,34514114-34514377,34514761-34514978, 34515759-34516030,34516190-34516559,34516578-34516797, 34516819-34518931,34518941-34519193,34519269-34519401, 34520597-34521114,34521207-34522115,34522195-34522368, 34522833-34522882,34523963-34524035,34524413-34524477, 34524736-34525522,34525622-34525878,34525989-34526109, 34526315-34526956 Length = 5320 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 171 SKHSFYSRNIYKFWDILNKAHQASIS-YD*NVTN 73 S HS Y +Y FW +K H AS++ Y VTN Sbjct: 3213 SAHSAYGDRVYSFWP-RSKQHPASLTGYGSTVTN 3245 >01_06_0192 + 27347369-27348826,27349124-27349264,27349350-27351081, 27353739-27354606,27354784-27355957 Length = 1790 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 598 FFFQDHIYVSTTVRLPFTLHCFLFR 672 FFF+D + + + P TLHC R Sbjct: 1748 FFFKDGVLIPPDITAPTTLHCSYMR 1772 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,014,650 Number of Sequences: 37544 Number of extensions: 240882 Number of successful extensions: 290 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -