BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1182 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0652 - 18424489-18424525,18424639-18424702,18424796-184248... 34 0.099 >04_03_0652 - 18424489-18424525,18424639-18424702,18424796-18424869, 18425809-18425924,18426078-18426343,18427659-18427749 Length = 215 Score = 34.3 bits (75), Expect = 0.099 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = +2 Query: 176 VFINCHFFAFCVNNYRFRYFIQTYFVS-----DGFIQFLFYISHFYYY 304 VF + A + N+ +RYF + ++V GF+Q L Y FYYY Sbjct: 154 VFFLGAYRALYILNWAYRYFTEPHYVHWITWISGFVQTLLYADFFYYY 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,721,309 Number of Sequences: 37544 Number of extensions: 234405 Number of successful extensions: 423 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -