BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1180 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 27 0.40 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 5.0 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 27.1 bits (57), Expect = 0.40 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = +1 Query: 112 INDILALFNTYVFHTVNIQNILMAQNRSKSILLRIFQVFIKSSFLHRL 255 I D+ + ++ + + + +L+ NR+ +LR +F SFL L Sbjct: 773 IRDLGIILDSRLNFKLQLDEVLLKANRTLGFILRFTSIFRDQSFLRNL 820 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 5.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 69 YLSRFCSSPCMYIYYK*HSRFIQHLRFSYR*YTEHI 176 Y +R C IY+ HS + + RF YR Y I Sbjct: 425 YQTRRCQRS-RSIYFDTHSLYCSYNRFRYRRYLSKI 459 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 478,478 Number of Sequences: 2352 Number of extensions: 8168 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -