BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1177 (787 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) 72 6e-13 SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) 72 6e-13 SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) 72 6e-13 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 72 6e-13 SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_10424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) 63 2e-10 SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) 63 2e-10 SB_18779| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6264| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_22121| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_10239| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_42346| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_36138| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_15035| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_25175| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_49084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34898| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46955| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 32 0.61 SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) 31 1.1 SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) 31 1.4 SB_45983| Best HMM Match : HLH (HMM E-Value=1.3) 30 1.8 SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) 30 2.4 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_29336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_52000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_3204| Best HMM Match : FGF (HMM E-Value=0.17) 29 4.3 SB_29775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42721| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_9945| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_47653| Best HMM Match : zf-CCHC (HMM E-Value=0.0017) 28 9.9 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 74.1 bits (174), Expect = 1e-13 Identities = 36/59 (61%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = +1 Query: 256 SGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRS-GVNLRNSNE 429 SGCL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE KS R G+ L+ + Sbjct: 723 SGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELKSARQRRLGLGLKGGGK 781 >SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 148 Score = 71.7 bits (168), Expect = 6e-13 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = +1 Query: 256 SGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 SGCL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 60 SGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 112 >SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 71.7 bits (168), Expect = 6e-13 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = +1 Query: 256 SGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 SGCL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 6 SGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 58 >SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) Length = 148 Score = 71.7 bits (168), Expect = 6e-13 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = +1 Query: 256 SGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 SGCL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 60 SGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 112 >SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 147 Score = 71.7 bits (168), Expect = 6e-13 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = +1 Query: 256 SGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 SGCL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 59 SGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 111 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 71.7 bits (168), Expect = 6e-13 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = +1 Query: 256 SGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 SGCL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 118 SGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 170 >SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 71.7 bits (168), Expect = 6e-13 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = +1 Query: 256 SGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 SGCL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 17 SGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 69 >SB_10424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 71.3 bits (167), Expect = 8e-13 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 256 SGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFK 384 SGCL +QP GGKLHL+LN+ RPIANKYREGK+K TLKRE K Sbjct: 34 SGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKSTLKRELK 76 >SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) Length = 187 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = -3 Query: 365 VLFNFPSRYLFAIGLAVIFSLRWSLPPA*GCTLKQPD 255 VLF FPSRYLFAIGL IFS RWSLPP GC KQPD Sbjct: 89 VLFIFPSRYLFAIGLVPIFSFRWSLPPILGCIPKQPD 125 >SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 156 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = -3 Query: 365 VLFNFPSRYLFAIGLAVIFSLRWSLPPA*GCTLKQPD 255 VLF FPSRYLFAIGL IFS RWSLPP GC KQPD Sbjct: 58 VLFIFPSRYLFAIGLVPIFSFRWSLPPILGCIPKQPD 94 >SB_18779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 44 >SB_6264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 44 >SB_22121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 3e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFKST*NRSGVNLRNSN 426 GGKLHL+LN+ RPIANKYREGK+K TLKRE K RS + R+SN Sbjct: 2 GGKLHLKLNIGKRPIANKYREGKMKSTLKRELK----RSRLPGRSSN 44 >SB_10239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 59.7 bits (138), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 384 GGKLHL+LN+ RPIANKYREGK+K TLKRE K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKRELK 34 >SB_42346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 59.7 bits (138), Expect = 3e-09 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 384 GGKLHL+LN+ RPIANKYREGK+K TLKRE K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKRELK 34 >SB_36138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 56.0 bits (129), Expect = 3e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 384 GGKLHL+LN+ RPIANKYREGK+K TLK+ K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKKRVK 34 Score = 31.9 bits (69), Expect = 0.61 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +3 Query: 348 GKVEKNFEERVQEYVKPFRGKP 413 GK++ ++RV++YVKP +GKP Sbjct: 23 GKMKSTLKKRVKKYVKPLKGKP 44 >SB_15035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 56.0 bits (129), Expect = 3e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 384 GGKLHL+LN+ RPIANKYREGK+K TLK+ K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLKKRVK 34 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +3 Query: 348 GKVEKNFEERVQEYVKPFRGK 410 GK++ ++RV++YVKP +GK Sbjct: 23 GKMKSTLKKRVKKYVKPLKGK 43 >SB_25175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 54.4 bits (125), Expect = 1e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 384 GGKLHL+LN+ RPIANKYREGK+K TL++ K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKMKSTLEKRVK 34 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +3 Query: 348 GKVEKNFEERVQEYVKPFRGK 410 GK++ E+RV++YVKP +GK Sbjct: 23 GKMKSTLEKRVKKYVKPLKGK 43 >SB_49084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTL 369 GGKLHL+LN+ RPIANKYREG++K TL Sbjct: 2 GGKLHLKLNIGTRPIANKYREGQMKSTL 29 >SB_34898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +1 Query: 286 GGKLHLRLNMTARPIANKYREGKLKRTLKREFK 384 GGKLHL+LN+ RPIANKYREGK ++ ++ K Sbjct: 2 GGKLHLKLNIGTRPIANKYREGKDEKHFEKRVK 34 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +3 Query: 348 GKVEKNFEERVQEYVKPFRGKPAKLE*TNGEIH 446 GK EK+FE+RV++YVK +GK L IH Sbjct: 23 GKDEKHFEKRVKKYVKTLKGKRMGLAMRRARIH 55 >SB_46955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 338 LFAIGLAVIFSLRWSLPPA*GCTLKQPD 255 + I + ++ + RWSLPP GC KQPD Sbjct: 23 IIIIIIILLHTRRWSLPPILGCIPKQPD 50 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 307 ALDGVYHPLRAALSSNPT 254 ALDGVYHP AA +NPT Sbjct: 58 ALDGVYHPFWAAFPNNPT 75 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 31.9 bits (69), Expect = 0.61 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 307 ALDGVYHPLRAALSSNPT 254 ALDGVYHP AA +NPT Sbjct: 344 ALDGVYHPFWAAFPNNPT 361 >SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 139 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 302 RWSLPPA*GCTLKQPD 255 RWSLPP GC KQPD Sbjct: 62 RWSLPPILGCIPKQPD 77 >SB_3203| Best HMM Match : FGF (HMM E-Value=0.013) Length = 423 Score = 30.7 bits (66), Expect = 1.4 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 3/95 (3%) Frame = +1 Query: 253 RSGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKS--T*NRSGVNLRNSN 426 R G + V+P GK+++RLN + R GK+ L R K NR G N Sbjct: 47 RHGKMYVRPNRHGKMYIRLNRHGKMYIRLNRHGKMYIRLNRHGKMYIRLNRHGKMYVRLN 106 Query: 427 ERTERFIVFSR-AYVYVRSDVDGTFVSCVVLRRHG 528 + ++ +R +Y+R + G + L RHG Sbjct: 107 RHGKMYVRPNRHGKMYIRLNRHGKMY--IRLNRHG 139 Score = 30.3 bits (65), Expect = 1.8 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Frame = +1 Query: 247 LLRSGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKS--T*NRSGVNLRN 420 L R G + V+P GK+++R N + R GK+ L R K NR G Sbjct: 35 LNRHGKMYVRPNRHGKMYVRPNRHGKMYIRLNRHGKMYIRLNRHGKMYIRLNRHGKMYIR 94 Query: 421 SNERTERFIVFSR-AYVYVRSDVDGTFVSCVVLRRHG 528 N + ++ +R +YVR + G + L RHG Sbjct: 95 LNRHGKMYVRLNRHGKMYVRPNRHGKMY--IRLNRHG 129 Score = 30.3 bits (65), Expect = 1.8 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Frame = +1 Query: 247 LLRSGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKS--T*NRSGVNLRN 420 L R G + V+P GK+++RLN + R GK+ R K NR G Sbjct: 105 LNRHGKMYVRPNRHGKMYIRLNRHGKMYIRLNRHGKMYVRPNRHGKMYVRPNRHGKMYIR 164 Query: 421 SNERTERFIVFSR-AYVYVRSDVDGTFVSCVVLRRHG 528 N + +I +R +Y+R + G + L RHG Sbjct: 165 LNRHGKMYIRLNRHCKMYIRLNRHGKMY--IRLNRHG 199 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Frame = +1 Query: 247 LLRSGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKS--T*NRSGVNLRN 420 L R G + V+P GK+++RLN + R GK+ L R K NR G Sbjct: 248 LNRHGKMYVRPNRHGKMYIRLNRHGKMYIRLDRNGKMYIRLNRHGKMYIRLNRHGKMYIR 307 Query: 421 SNERTERFIVFSR-AYVYVRSDVDG 492 N + +I +R +Y+R + G Sbjct: 308 LNRHGKMYIRLNRHGKMYIRLNRHG 332 Score = 28.7 bits (61), Expect = 5.6 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 3/97 (3%) Frame = +1 Query: 247 LLRSGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKS--T*NRSGVNLRN 420 L R G + ++ GK+++RLN + R GK+ L R K +R+G Sbjct: 228 LKRHGQMYIRLNRHGKMYIRLNRHGKMYVRPNRHGKMYIRLNRHGKMYIRLDRNGKMYIR 287 Query: 421 SNERTERFIVFSR-AYVYVRSDVDGTFVSCVVLRRHG 528 N + +I +R +Y+R + G + L RHG Sbjct: 288 LNRHGKMYIRLNRHGKMYIRLNRHGKMY--IRLNRHG 322 Score = 28.3 bits (60), Expect = 7.5 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +1 Query: 289 GKLHLRLNMTARPIANKYREGKLKRTLKREFKS--T*NRSGVNLRNSNERTERFIVFSR- 459 GK+++RLN + R GK+ L R K NR G N + +I +R Sbjct: 9 GKMYIRLNRHGKMYIRLNRHGKMYIRLNRHGKMYVRPNRHGKMYVRPNRHGKMYIRLNRH 68 Query: 460 AYVYVRSDVDGTFVSCVVLRRHG 528 +Y+R + G + L RHG Sbjct: 69 GKMYIRLNRHGKMY--IRLNRHG 89 >SB_45983| Best HMM Match : HLH (HMM E-Value=1.3) Length = 68 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 304 LDGVYHPLRAALSSNPT 254 LDGVYHP AA +NPT Sbjct: 2 LDGVYHPFWAAFPNNPT 18 >SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) Length = 1130 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -2 Query: 285 RLGLH--SQATRPKERPSRRDPPSLRAWHPLRENG 187 RLG+H S AT + PSRR PPS+ H +R+ G Sbjct: 713 RLGVHKHSVATHVEADPSRRRPPSVHRCH-IRKGG 746 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 307 ALDGVYHPLRAALSSNPT 254 ALDG YHP AA +NPT Sbjct: 58 ALDGFYHPFWAAFPNNPT 75 >SB_29336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1047 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 Query: 565 EVHVFSGR*TFTYRADGERRTKRTFRQH 482 EV++ R TF RADGERRT+ +H Sbjct: 1017 EVYIAVNRKTFRTRADGERRTRGGRARH 1044 >SB_52000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.1 bits (62), Expect = 4.3 Identities = 10/19 (52%), Positives = 17/19 (89%) Frame = +3 Query: 354 VEKNFEERVQEYVKPFRGK 410 ++ +FE+RV++YVKP +GK Sbjct: 1 MKSHFEKRVKKYVKPLKGK 19 >SB_3204| Best HMM Match : FGF (HMM E-Value=0.17) Length = 249 Score = 29.1 bits (62), Expect = 4.3 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 3/97 (3%) Frame = +1 Query: 247 LLRSGCLRVQP*AGGKLHLRLNMTARPIANKYREGKLKRTLKREFKS--T*NRSGVNLRN 420 L R G + V+P GK++ RLN + R GK+ R K NR G Sbjct: 149 LNRHGKMYVRPNRHGKMYFRLNRHGKMYVRLNRHGKMYVRPNRHGKMYIRLNRHGKMYIG 208 Query: 421 SNERTERFIVFSR-AYVYVRSDVDGTFVSCVVLRRHG 528 N + +I +R +Y+R + G + L RHG Sbjct: 209 LNRHGKMYIRLNRHGKMYIRLNRHGKMY--IRLDRHG 243 >SB_29775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 300 MEFTTRLGLH--SQATRPKERPSRRDPPSLRAWH 205 + F RLG+H S T + PSRR PPS+ H Sbjct: 237 VRFGLRLGVHKHSVVTHVEADPSRRRPPSVHRCH 270 >SB_42721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -2 Query: 285 RLGLHSQ--ATRPKERPSRRDPPSL 217 RLG+H Q AT + PSRR PPS+ Sbjct: 440 RLGVHKQNVATHVEADPSRRRPPSV 464 >SB_9945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +3 Query: 366 FEERVQEYVKPFRGK 410 FE+RV++YVKP +GK Sbjct: 5 FEKRVKKYVKPLKGK 19 >SB_47653| Best HMM Match : zf-CCHC (HMM E-Value=0.0017) Length = 759 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 662 RIVPIHAFGRYH*TNHARVEKFLKKIFSYASGPTKSTS 775 R P+H F H H E KK FS+ T TS Sbjct: 595 RCTPLHPFSPLHFNQHTTQETPHKKFFSFQRCSTHGTS 632 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = -2 Query: 300 MEFTTRLGLHSQATRPKERPS-----RRDPPSLRAWHPLREN 190 MEFTT GLHSQ T P R PP + P E+ Sbjct: 1 MEFTTHFGLHSQTTSNSCSPGDPLVLERPPPRWSSNSPYSES 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,089,744 Number of Sequences: 59808 Number of extensions: 483509 Number of successful extensions: 1416 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1399 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -