BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1175 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 8e-20 SB_43122| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 65 4e-11 SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 63 2e-10 SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44926| Best HMM Match : Attractin (HMM E-Value=7) 63 2e-10 SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36156| Best HMM Match : Attractin (HMM E-Value=7) 63 2e-10 SB_36112| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 63 2e-10 SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) 63 2e-10 SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 63 2e-10 SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 63 2e-10 SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17306| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 63 2e-10 SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7349| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_5041| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_2907| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_574| Best HMM Match : PapG_N (HMM E-Value=8) 63 2e-10 SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59785| Best HMM Match : TBCA (HMM E-Value=3) 63 2e-10 SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003) 63 2e-10 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 63 2e-10 SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56810| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 63 2e-10 SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 63 2e-10 SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43409| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42287| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42013| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.8) 63 2e-10 SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41155| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38615| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37587| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37354| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33170| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32512| Best HMM Match : Chlam_OMP3 (HMM E-Value=4.2) 63 2e-10 SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31547| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29925| Best HMM Match : GYF (HMM E-Value=6.8) 63 2e-10 SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7) 63 2e-10 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 63 2e-10 SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26861| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 63 2e-10 SB_26658| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25285| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25254| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25043| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24889| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24879| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24857| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24789| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24500| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24211| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23470| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23311| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23121| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22956| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 63 2e-10 SB_21855| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21849| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21590| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21260| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21251| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21222| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21067| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20387| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20159| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 >SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 94.3 bits (224), Expect = 8e-20 Identities = 43/54 (79%), Positives = 45/54 (83%) Frame = +2 Query: 431 GEQSNAWRILLRNDRKSRHRRIEKQRAMNAWLPQASYPCGNFSGTSC*KLFILK 592 GEQSN WRILLRNDRKSRHRRI+KQR +AWLPQASYPCGNFS TS KL K Sbjct: 2 GEQSNTWRILLRNDRKSRHRRIKKQRRYDAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.3 bits (75), Expect = 0.094 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGS+ AF V + TE+ +Q SF PFV Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFV 80 >SB_43122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.1 bits (159), Expect = 6e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 492 LRCRLFLSLRSKIRQALDCSPIKRERELGLDRRET 388 LRCRLFLSLRS+IRQ LDCSP RERELGLDRRET Sbjct: 15 LRCRLFLSLRSRIRQVLDCSPTNRERELGLDRRET 49 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +2 Query: 428 MGEQSNAWRILLRNDRKSRHRRIEKQRAMNAWLPQASYPC 547 +GEQSN WRILLRNDRKS + AMNAWLPQASYPC Sbjct: 97 VGEQSNTWRILLRNDRKSDIEGSKSNVAMNAWLPQASYPC 136 >SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNV 28 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 29 AMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFV 81 >SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 35.1 bits (77), Expect = 0.054 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVGIHTENQNQVSFYPFV 80 >SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTS 568 AMNAWLPQASYPCGNFS TS Sbjct: 28 AMNAWLPQASYPCGNFSDTS 47 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI F V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHTFTVCIHTENQNQVSFYPFV 80 >SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.3 bits (75), Expect = 0.094 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGS+ AF V + TE+ +Q SF PFV Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFV 80 >SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFV 118 >SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNV 66 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 67 AMNAWLPQASYPCGNFSDTSSLKLLKTK 94 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFFPFV 119 >SB_44926| Best HMM Match : Attractin (HMM E-Value=7) Length = 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNV 28 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGN S TS KL K Sbjct: 29 AMNAWLPQASYPCGNLSDTSSLKLLKTK 56 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFV 81 >SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +2 Query: 512 MNAWLPQASYPCGNFSGTSC*KLFILK 592 MNAWLPQASYPCGNFS TS KL K Sbjct: 29 MNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFV 118 >SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 70 WVNNPTLGEFCFAMIGRADIEGSKSNV 96 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 97 AMNAWLPQASYPCGNFSDTSSLKLLKTK 124 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSFYPFV 149 >SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPC NFS TS KL K Sbjct: 28 AMNAWLPQASYPCRNFSDTSSLKLLKTK 55 >SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.3 bits (75), Expect = 0.094 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGS+ AF V + TE+ +Q SF PFV Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFV 80 >SB_36156| Best HMM Match : Attractin (HMM E-Value=7) Length = 162 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFV 118 >SB_36112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 35.1 bits (77), Expect = 0.054 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 509 AMNAWLPQASYPC 547 AMNAWLPQASYPC Sbjct: 66 AMNAWLPQASYPC 78 >SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 70 WVNNPTLGEFCFAMIGRADIEGSKSNV 96 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 97 AMNAWLPQASYPCGNFSDTSSLKLLKTK 124 >SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNV 66 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 67 AMNAWLPQASYPCGNFSDTSSLKLLKTK 94 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFYPFV 119 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 348 WVNNPTLGEFCFAMIGRADIEGSKSNV 374 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 375 AMNAWLPQASYPCGNFSDTSSLKLLKTK 402 Score = 34.3 bits (75), Expect = 0.094 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 401 TKGSIGHAFTVCIHTENHNQVSFYPFV 427 >SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 35.1 bits (77), Expect = 0.054 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI+ AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIAHAFTVCIHTENQNQVSFYPFV 80 >SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNV 28 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 29 AMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFV 81 >SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.3 bits (75), Expect = 0.094 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFPVCIHTENQNQVSFYPFV 80 >SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNV 66 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 67 AMNAWLPQASYPCGNFSDTSSLKLLKTK 94 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFYPFV 119 >SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 48.0 bits (109), Expect = 7e-06 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGN+S TS KL K Sbjct: 28 AMNAWLPQASYPCGNYSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 >SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) Length = 128 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFV 118 >SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNV 28 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 29 AMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 31.5 bits (68), Expect = 0.67 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q S PFV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSSYPFV 81 >SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS T KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTCSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNV 28 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 29 AMNAWLPQASYPCGNFSDTSSLKLLKTK 56 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFV 81 >SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 19 WVNNPTLGEFCFAMIGRADIEGSKSNV 45 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 46 AMNAWLPQASYPCGNFSDTSSLKLLKTK 73 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 72 TKGSIGHAFTVCIHTENQNQVSFYPFV 98 >SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) Length = 128 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 153 WVNNPTLGEFCFAMIGRADIEGSKSNV 179 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 180 AMNAWLPQASYPCGNFSDTSSLKLLKTK 207 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 206 TKGSIGHAFTVCIHTENQNQVSFYPFV 232 >SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNV 65 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 66 AMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFV 118 >SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_17306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNV 66 Score = 35.1 bits (77), Expect = 0.054 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 509 AMNAWLPQASYPC 547 AMNAWLPQASYPC Sbjct: 67 AMNAWLPQASYPC 79 >SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 70 WVNNPTLGEFCFAMIGRADIEGSKSNV 96 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 97 AMNAWLPQASYPCGNFSDTSSLKLLKTK 124 >SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 32 WVNNPTLGEFCFAMIGRADIEGSKSNV 58 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 59 AMNAWLPQASYPCGNFSDTSSLKLLKTK 86 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 85 TKGSIGHAFTVCIHTENQNQVSFYPFV 111 >SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 70 WVNNPTLGEFCFAMIGRADIEGSKSNV 96 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 97 AMNAWLPQASYPCGNFSDTSSLKLLKTK 124 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSFYPFV 149 >SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.3 bits (75), Expect = 0.094 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQESFYPFV 80 >SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGS+ AF V + TE+ +Q SF PFV Sbjct: 54 TKGSMGHAFTVCIHTENQNQVSFYPFV 80 >SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 >SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 429 WVNNPTLGEFCFAMIGRADIEGSKSNV 509 WVNNPTLGEFCFAMIGRADIEGSKSNV Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNV 27 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +2 Query: 509 AMNAWLPQASYPCGNFSGTSC*KLFILK 592 AMNAWLPQASYPCGNFS TS KL K Sbjct: 28 AMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 34.7 bits (76), Expect = 0.071 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 586 TKGSISRAFAVPMRTEHLDQASFCPFV 666 TKGSI AF V + TE+ +Q SF PFV Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFV 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,474,738 Number of Sequences: 59808 Number of extensions: 468094 Number of successful extensions: 3330 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3327 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -