BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1173 (771 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.59 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.59 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) 29 3.1 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) 29 5.5 SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) 28 7.3 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 9.6 SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -2 Query: 413 DVVAVSQAPSPESNPDSPLPVTTM 342 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 404 AVSQAPSPESNPDSPLPVTTM 342 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = +2 Query: 521 LNILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 661 ++++ R +WRASL Y K+VAVKKLVV F VG P Sbjct: 56 MHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 102 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/42 (47%), Positives = 22/42 (52%) Frame = +2 Query: 536 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 661 R +WRASL Y K+VAVKKLVV F VG P Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 55 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.027 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +2 Query: 2 VICLSQRLSHACLSASRIKAIPRMA 76 VICLSQRLSHACLS S RMA Sbjct: 137 VICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.048 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +2 Query: 2 VICLSQRLSHACLSASRIKAIPRMA 76 VICLSQRLSHACLS S RMA Sbjct: 113 VICLSQRLSHACLSISTRTVKLRMA 137 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.063 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 403 PFLRLPLRNRTLIPRYP 353 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.59 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 3 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 137 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.59 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 3 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 137 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.78 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 548 RASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 661 RASL Y K+VAVKKLVV F VG P Sbjct: 5 RASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 42 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +2 Query: 536 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 661 R ASL Y K+VAVKKLVV F VG P Sbjct: 24 RERRAASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 65 >SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) Length = 111 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 596 YTKIVAVKKLVVAFVRRAVGAP 661 Y K+VAVKKLVV F VG P Sbjct: 88 YIKVVAVKKLVVGFRDGTVGPP 109 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 596 YTKIVAVKKLVVAFVRRAVGAP 661 Y K+VAVKKLVV F VG P Sbjct: 89 YIKVVAVKKLVVGFRDGTVGPP 110 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 596 YTKIVAVKKLVVAFVRRAVGAP 661 Y K+VAVKKLVV F VG P Sbjct: 17 YIKVVAVKKLVVGFRDGTVGPP 38 >SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) Length = 203 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 634 CNYELFNRNNFSIRYWSWNYRGCWH 560 C + RN +RYW W R C H Sbjct: 91 CEVTVIARNILPVRYWIWLSRKCGH 115 >SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) Length = 1050 Score = 28.3 bits (60), Expect = 7.3 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -3 Query: 757 EHRDRILILNRRFLERRLTDDMSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWSWN 578 E RD L NR+ ++ + +V P + S + + + FSI YW W+ Sbjct: 453 ELRDTYLTENRQLNMYDYRENDGIDCAVWPHLYPYHSWSRRSAATSLDTKTFSIEYWRWH 512 Query: 577 YR 572 +R Sbjct: 513 HR 514 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 422 PSLDVVAVSQAPSPESNPDSPLP 354 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 673 SPRMRCTDSAAHKCNYELFNRNNFSIRYW-SWNY 575 S R+RCT S + KC + + F W S+NY Sbjct: 147 SYRLRCTSSTSWKCRLTSISESYFKGNNWFSYNY 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,067,838 Number of Sequences: 59808 Number of extensions: 506036 Number of successful extensions: 1304 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1304 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -