BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1173 (771 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 1.5 At5g67270.1 68418.m08480 microtubule-associated EB1 family prote... 30 1.9 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 4.5 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 4.5 At4g38560.1 68417.m05459 expressed protein 28 7.9 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 249 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 154 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At5g67270.1 68418.m08480 microtubule-associated EB1 family protein similar to SP|Q9UPY8 Microtubule-associated protein RP/EB family member 3 (Protein EB3) {Homo sapiens}; contains Pfam profiles PF00307: Calponin homology (CH) domain, PF03271: EB1 protein Length = 329 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = -3 Query: 760 EEHRDRILILNRRFLERRLTDDMSANVSVSPRMRCTDSAAHKCN 629 EE R+ + +R L L D++A ++SPR R +D++ KC+ Sbjct: 278 EERRNSVTESQKRKLIVNLDVDVAAITTLSPRQRLSDASDVKCS 321 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -2 Query: 431 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 330 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 422 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 315 PS A + APSP +NP P T V++ ES Sbjct: 39 PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74 >At4g38560.1 68417.m05459 expressed protein Length = 521 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 1 SYMLVSKIKPCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILEL 144 SY + + + + + GD A+GS Q +SYS+ + V+LEL Sbjct: 341 SYKVRASVSSTLQKILDKHGDIASGSKLQSLRTKSYSLETLAAVVLEL 388 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,381,062 Number of Sequences: 28952 Number of extensions: 336257 Number of successful extensions: 792 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -