BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1170 (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 25 2.0 L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 23 6.0 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 25.0 bits (52), Expect = 2.0 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = -3 Query: 291 RKNVRMLNSRKSNVETPEKRQKRQHRNCKAILTE*IRPCVSDEKYTFRHS 142 R+ R L + S + + + KRQ + CK + + V +EK F S Sbjct: 653 REQKRDLQEQLSKYQQTKMKVKRQEQKCKELTARLVN--VDEEKVKFERS 700 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 23.4 bits (48), Expect = 6.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 253 RRDPGKKTKKTTPELQSDFDRIDPALCF 170 RRDP K+ + +P + + +D I L F Sbjct: 106 RRDPNKQKRPRSPNVTAVYDAILEDLVF 133 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,244 Number of Sequences: 2352 Number of extensions: 9039 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -