BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1167 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164,678... 54 1e-07 10_08_0338 + 16916429-16916650,16916728-16917900 53 2e-07 06_03_0500 + 21470681-21470952,21471049-21471089,21472322-214724... 48 6e-06 11_06_0497 + 24337772-24337993,24338042-24338083,24338176-24339357 48 1e-05 07_03_1061 + 23651404-23651625,23651764-23652954 48 1e-05 07_01_0182 + 1280479-1280754,1281232-1282089 45 5e-05 08_02_1101 - 24308433-24308978,24309195-24309364,24309443-243095... 44 2e-04 11_02_0073 - 8020401-8020512,8020594-8020679,8020761-8020921,802... 42 5e-04 04_04_0674 + 27173948-27174188,27174704-27175260,27175310-271753... 40 0.001 08_02_0181 + 13923658-13923661,13925518-13925681,13925879-139259... 40 0.002 10_01_0298 - 3094197-3094307,3095093-3095253,3095462-3095666,309... 40 0.003 02_05_0506 + 29613307-29613601,29613641-29613678,29613679-296138... 40 0.003 01_07_0160 - 41563109-41563468,41563566-41563985,41564082-415642... 40 0.003 01_06_0833 + 32296957-32297256,32299257-32299895 39 0.005 09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174... 38 0.006 01_07_0120 + 41185884-41186127,41187228-41187310,41188596-411886... 38 0.006 12_02_0871 + 23865343-23866016,23866122-23866170,23866276-238663... 38 0.008 03_06_0523 + 34499533-34499705,34499808-34499917,34500037-345002... 38 0.008 09_06_0308 - 22199389-22199451,22199604-22199924,22200178-222004... 37 0.014 09_04_0424 + 17444261-17444665,17445974-17446367,17447367-174474... 36 0.024 06_03_0794 - 24671955-24672362,24672469-24672505,24672804-246728... 36 0.032 03_06_0105 + 31675083-31675313,31676171-31676815 36 0.032 02_02_0008 + 6061508-6061624,6062468-6062566,6062636-6063039,606... 36 0.042 01_06_1533 + 38041499-38041681,38041853-38041985,38042816-380429... 36 0.042 05_04_0092 + 17851085-17851346,17852778-17852860,17853891-178539... 35 0.056 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 35 0.074 04_03_0876 + 20493213-20493339,20493574-20493642,20493745-20493890 35 0.074 03_02_0613 - 9848514-9848539,9848942-9849200,9849326-9849365,984... 34 0.13 02_05_0796 + 31800256-31800528,31800635-31800758,31802642-318027... 34 0.13 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 33 0.17 10_02_0023 + 4306350-4306908,4308429-4308814,4308917-4308991,430... 33 0.23 07_03_1175 - 24555965-24556117,24557809-24558264,24558270-245584... 33 0.23 06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448,622... 33 0.23 04_04_1223 + 31851545-31852609,31854314-31854773,31856201-318562... 33 0.23 09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801,116... 33 0.30 07_03_1586 - 27929947-27930056,27930143-27930286,27930377-279307... 33 0.30 01_06_0006 - 25517892-25517935,25518156-25518276,25518598-255187... 33 0.30 01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668,298... 33 0.30 10_08_0154 + 15266430-15266953,15267748-15267820,15267893-152679... 32 0.39 08_02_0526 + 18184146-18184168,18184247-18184438,18184846-181849... 32 0.39 08_02_0162 + 13464698-13464974,13465719-13465837,13465920-134665... 32 0.39 02_04_0289 + 21615745-21616155,21617417-21617870,21618162-216182... 32 0.52 01_07_0243 + 42240553-42240750,42241114-42241255,42242327-42242442 32 0.52 01_06_1408 - 37088014-37088448,37088892-37089167,37090777-37092297 32 0.52 03_02_0346 - 7666500-7666646,7666744-7666902 31 0.69 03_01_0160 + 1302366-1302731,1303318-1303364,1303455-1303800 31 0.69 07_01_0286 + 2086630-2086856,2087052-2087067 31 0.91 05_01_0112 - 757514-758444,758525-758571,759074-759236,759861-76... 31 0.91 07_03_1378 + 26158233-26158562,26159075-26159176,26159551-261598... 31 1.2 07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637 31 1.2 04_04_0435 - 25170348-25170593,25170989-25171189,25171580-251717... 31 1.2 08_02_1098 - 24291138-24291851,24292607-24292861 30 1.6 07_02_0019 + 11877119-11879984,11880316-11880389,11881293-118815... 30 1.6 07_01_0413 - 3155080-3155274,3155628-3155933,3156062-3156163,315... 30 1.6 02_01_0304 + 2037718-2037939,2038169-2038384,2038862-2039329,203... 30 1.6 12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-10... 30 2.1 11_01_0014 + 108647-108816,109704-109803,109891-110018,110232-11... 30 2.1 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 30 2.1 01_06_1799 + 39948481-39948607,39948694-39948762,39948859-399489... 30 2.1 03_06_0587 - 34921535-34922041,34922579-34922689 29 2.8 02_02_0387 - 9606744-9607475 29 2.8 01_05_0696 - 24366857-24368200 29 3.7 08_02_1039 - 23866743-23866862,23866985-23867266,23867868-238679... 29 4.8 07_01_1143 - 10711023-10711884,10713603-10713826,10714253-107145... 29 4.8 04_03_0489 + 16503325-16503747,16503916-16503978 29 4.8 04_03_0283 + 13887388-13887573,13887711-13887806,13888517-138886... 29 4.8 03_03_0130 - 14699658-14699723,14699828-14700109,14700444-147005... 29 4.8 03_01_0373 - 2904914-2904949,2905030-2905144,2906446-2906534,290... 29 4.8 12_02_0849 - 23640091-23640279,23640537-23640677,23640756-236422... 28 6.4 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 28 6.4 07_03_0188 - 14846308-14846690,14847136-14847247 28 6.4 03_02_0609 - 9823120-9823573,9823903-9824102,9824240-9824335,982... 28 6.4 11_06_0418 - 23317077-23317343,23317614-23317787,23317886-233179... 28 8.5 07_03_1347 + 25932185-25932748,25933151-25933755,25935797-259362... 28 8.5 03_05_0066 - 20455976-20456161,20456251-20456347,20456608-204567... 28 8.5 02_01_0447 - 3220489-3220560,3221287-3221420,3221500-3221731,322... 28 8.5 01_01_0955 - 7494486-7496327 28 8.5 >02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164, 6785291-6785454,6786781-6786821,6786933-6787129 Length = 397 Score = 53.6 bits (123), Expect = 1e-07 Identities = 27/61 (44%), Positives = 37/61 (60%) Frame = +2 Query: 56 IIVTRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMY 235 +I RT++ K PR K G K+F+GGLPS++TE +LR F YGK++E IM Sbjct: 129 VIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSSLTEDELREHFSPYGKIVEHQIML 188 Query: 236 D 238 D Sbjct: 189 D 189 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 122 GGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 G K+F+GG+ TE F +YG + + VIM D+ K Sbjct: 62 GDSSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTK 104 >10_08_0338 + 16916429-16916650,16916728-16917900 Length = 464 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/44 (50%), Positives = 31/44 (70%) Frame = +2 Query: 122 GGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 G K+F+GGLPSN+TE + R +F YG V +VV+MYDQ ++ Sbjct: 124 GARTKKIFVGGLPSNLTEDEFRQYFQTYGVVTDVVVMYDQNTQR 167 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ TE LR F YG V + +M D+ Sbjct: 7 KLFIGGISWETTEEKLRDHFAAYGDVSQAAVMRDK 41 >06_03_0500 + 21470681-21470952,21471049-21471089,21472322-21472485, 21472577-21472679,21472806-21472975,21473766-21474239 Length = 407 Score = 48.4 bits (110), Expect = 6e-06 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +2 Query: 68 RTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 RT++ K PR K G K+F+GG+P ++TE L+ F YGKV+E IM D Sbjct: 158 RTVEVKRTVPREEMSSKDGPKTRKIFVGGIPPSLTEDKLKEHFSSYGKVVEHQIMLD 214 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +2 Query: 98 RTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 RT + G K+F+GG+ TE F +YG + + VIM D+ K Sbjct: 79 RTAGGGEGGDSSGKIFVGGVAWETTEESFTKHFEKYGAISDSVIMKDKHTK 129 >11_06_0497 + 24337772-24337993,24338042-24338083,24338176-24339357 Length = 481 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/39 (46%), Positives = 28/39 (71%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGL S VTE D R +F ++G + +VV+MYD ++ Sbjct: 121 KIFVGGLASTVTEADFRKYFEQFGTITDVVVMYDHNTQR 159 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ + E LR +F +YG+V+E VIM D+ Sbjct: 7 KLFIGGISWDTNEDRLREYFDKYGEVVEAVIMRDR 41 >07_03_1061 + 23651404-23651625,23651764-23652954 Length = 470 Score = 47.6 bits (108), Expect = 1e-05 Identities = 18/39 (46%), Positives = 29/39 (74%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGL SNVTE + R +F ++G + +VV+MYD ++ Sbjct: 107 KIFVGGLASNVTEVEFRRYFEQFGVITDVVVMYDHNTQR 145 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ E LR +F R+G+V E VIM D+ Sbjct: 7 KLFVGGISWETDEDRLREYFSRFGEVTEAVIMRDR 41 >07_01_0182 + 1280479-1280754,1281232-1282089 Length = 377 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = +2 Query: 122 GGGYP----KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 GGG+ K+F+GG+P++ E +LR FG+YG V V++M D+E Sbjct: 12 GGGFVGERRKLFVGGIPTSAQEAELRGHFGQYGAVRSVIVMRDKE 56 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/34 (47%), Positives = 25/34 (73%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 KVF+GGL N+TE + + +F +G V +VV++YD Sbjct: 145 KVFIGGLRDNITEEEFKTYFESFGTVTDVVVIYD 178 >08_02_1101 - 24308433-24308978,24309195-24309364,24309443-24309542, 24310337-24310500,24310960-24310996,24311222-24311262, 24313877-24314093 Length = 424 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGLP +TE D + FF +YG V++ IM D + K+ Sbjct: 174 KIFVGGLPQALTEDDFKHFFQKYGPVVDHQIMRDHQTKR 212 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 134 PKVFLGGLPSNVT-ETDLRVFFGRYGKVMEVVIMYDQ 241 P+ G LP E D FG+YG++++ VIM D+ Sbjct: 84 PRKMYGNLPCREPDEADFVKHFGQYGEIVDSVIMRDK 120 >11_02_0073 - 8020401-8020512,8020594-8020679,8020761-8020921, 8021196-8021400,8021664-8021697,8022352-8022422, 8023363-8023542,8023625-8023765,8023859-8023975, 8024074-8024469 Length = 500 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +VF+GGLP + TE DLR +G++ EV +M D+E K+ Sbjct: 105 EVFIGGLPRDTTEEDLRELCDSFGEIYEVRLMKDKETKE 143 >04_04_0674 + 27173948-27174188,27174704-27175260,27175310-27175399, 27175475-27175714,27175801-27176022,27176124-27176433, 27176528-27176847,27176906-27177021,27177133-27177227, 27177331-27177407,27177520-27177615 Length = 787 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +VF+GGL + TE+DLR FG G++ EV +M + KK Sbjct: 191 EVFVGGLDKDATESDLRKVFGEVGEITEVRLMMNPVTKK 229 >08_02_0181 + 13923658-13923661,13925518-13925681,13925879-13925978, 13926072-13926244,13926486-13927016 Length = 323 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGLPS + E + + FF ++GKV+E I+ D + Sbjct: 77 KIFVGGLPSALKEDEFKEFFSKFGKVVEHEIIRDHSTNR 115 >10_01_0298 - 3094197-3094307,3095093-3095253,3095462-3095666, 3096349-3096534,3096616-3096756,3096843-3096959, 3097046-3097456 Length = 443 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/39 (43%), Positives = 26/39 (66%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +VF+GGLP + TE DL +G++ EV +M D+E K+ Sbjct: 110 EVFIGGLPRDTTEDDLHELCEAFGEISEVRLMKDKETKE 148 >02_05_0506 + 29613307-29613601,29613641-29613678,29613679-29613802, 29614358-29614484,29614915-29615002,29615539-29615631, 29616380-29616529 Length = 304 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/37 (43%), Positives = 25/37 (67%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 Y KVF+GGL T LR F+ R+G+++E V++ D+ Sbjct: 36 YTKVFVGGLAWETTSERLRRFYDRFGEILEAVVITDR 72 >01_07_0160 - 41563109-41563468,41563566-41563985,41564082-41564263, 41564362-41564542,41565066-41565084,41565185-41565445, 41566140-41566253,41566264-41566331,41566890-41567018, 41567141-41567245,41567317-41567456,41567519-41567687, 41567824-41567900,41568133-41568187,41568660-41568705, 41568806-41568894,41568996-41569061,41569360-41569425, 41569817-41569906,41570009-41570026 Length = 884 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/43 (34%), Positives = 27/43 (62%) Frame = +2 Query: 119 RGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEK 247 +G G K+F+G LP DLR +FG++G++++ I D ++ Sbjct: 234 QGMGNKKIFVGRLPQEANTEDLRHYFGKFGRIVDAYIPKDPKR 276 >01_06_0833 + 32296957-32297256,32299257-32299895 Length = 312 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 K+F+GGLP + TE L+ +F ++G+V +++ D K Sbjct: 125 KIFVGGLPVSATEKKLKEYFNKFGEVNRAIVVIDLNTK 162 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKV 214 KVF+GG+P +E++LR F R+G V Sbjct: 30 KVFVGGVPLGTSESELRAHFSRFGTV 55 >09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052, 1741559-1741641,1741733-1741784,1742038-1742105, 1742279-1742345,1742426-1742505,1742576-1742640, 1742785-1742847,1743271-1743427,1743511-1743588, 1743677-1744219,1744321-1744497,1744534-1744788, 1745270-1745329,1745874-1745888,1746123-1746135, 1746819-1746934 Length = 793 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 Y K+F+G +P TE D+R F +G V+EV ++ D++ Sbjct: 121 YVKLFIGSVPRTATEDDVRPLFEEHGDVVEVALIKDRK 158 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 107 QKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLG 259 ++ + G K+F+ L T ++ F YG V +V IM D ++ G Sbjct: 204 ERERHGAIEHKLFVASLNKQATAKEIEEIFAPYGHVEDVYIMKDGMRQSRG 254 >01_07_0120 + 41185884-41186127,41187228-41187310,41188596-41188647, 41188729-41188854,41188967-41189049,41189308-41189490, 41189901-41190237,41190607-41190750,41190854-41190939, 41191069-41191113 Length = 460 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMY-DQEKKKLG 259 K+F+G LP NVT+T+L F +YG + ++ I+ Q+ K G Sbjct: 129 KLFIGMLPKNVTDTELTDLFSKYGNIKDLQILRGSQQTSKAG 170 >12_02_0871 + 23865343-23866016,23866122-23866170,23866276-23866356, 23866599-23866718,23866957-23867055,23867135-23867194, 23867316-23867410,23867483-23867508,23869212-23869285, 23870194-23870259,23871027-23871099,23871585-23871622, 23873758-23873871,23876079-23876195,23876288-23876368, 23876468-23876536,23876631-23876669,23876809-23876973, 23877380-23877484,23877569-23877637,23877754-23877816, 23877903-23878021,23878124-23878348,23878409-23878610 Length = 940 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +2 Query: 104 LQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 + P R +VF+GGLP +VTE LR F G+++++ IM DQ Sbjct: 398 IANPDRRVKGAEVFVGGLPRSVTERALREVFSPCGEIVDLRIMKDQ 443 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 143 FLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 F+G LP+NVTE LR F G+V+ V + Sbjct: 567 FVGNLPANVTEEYLRKLFEHCGEVVRVAV 595 >03_06_0523 + 34499533-34499705,34499808-34499917,34500037-34500224, 34500984-34501451 Length = 312 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/34 (44%), Positives = 26/34 (76%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 VF+GG+P ++TE DL F +YG+V++V ++ D+ Sbjct: 38 VFVGGIPYDLTEGDLLAVFAQYGEVVDVNLVRDK 71 >09_06_0308 - 22199389-22199451,22199604-22199924,22200178-22200423, 22202152-22203337,22203487-22203551,22204205-22204486, 22205005-22205106,22205587-22206105 Length = 927 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +2 Query: 86 PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 P R + P++ G ++++G LP V ++ L F +GKV++ ++YD+E Sbjct: 221 PRGARVERPPRQFGPSFRIYVGNLPWQVDDSRLVQLFSEHGKVVDARVVYDRE 273 >09_04_0424 + 17444261-17444665,17445974-17446367,17447367-17447425, 17447507-17447637,17447737-17447833,17447936-17448100 Length = 416 Score = 36.3 bits (80), Expect = 0.024 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 VF+GGL NV+E DLR F +YG++ V I Sbjct: 287 VFVGGLDPNVSEDDLRQTFSQYGEISSVKI 316 >06_03_0794 - 24671955-24672362,24672469-24672505,24672804-24672858, 24674044-24674167,24674670-24674903 Length = 285 Score = 35.9 bits (79), Expect = 0.032 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 Y KVF+GGL LR F YG+++E V++ D+ Sbjct: 32 YTKVFVGGLAWETRSEGLRAHFEAYGEILEAVVITDR 68 >03_06_0105 + 31675083-31675313,31676171-31676815 Length = 291 Score = 35.9 bits (79), Expect = 0.032 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 K+F+ GLP E DLR F RYG+V+ ++ D Sbjct: 6 KLFVAGLPQQTREGDLRGHFARYGEVVHTRVVLD 39 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 KVF+GGL VT DL +F ++G + + V+M Sbjct: 113 KVFVGGLHETVTVKDLISYFEKFGTITDAVVM 144 >02_02_0008 + 6061508-6061624,6062468-6062566,6062636-6063039, 6064218-6064278,6064413-6064466,6064786-6064854, 6064993-6065058,6065162-6065230,6065448-6065537 Length = 342 Score = 35.5 bits (78), Expect = 0.042 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 V++GGLP E LR FGR+G ++ V ++ DQ Sbjct: 11 VYVGGLPYEANEDMLRDAFGRFGTIVSVKVINDQ 44 >01_06_1533 + 38041499-38041681,38041853-38041985,38042816-38042954, 38043331-38043367,38045606-38045897,38046384-38046502 Length = 300 Score = 35.5 bits (78), Expect = 0.042 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 Y KVF+GGL + +R +F ++G+++E V++ D+ Sbjct: 15 YTKVFVGGLAWETQKETMRKYFEQFGEILEAVVITDK 51 >05_04_0092 + 17851085-17851346,17852778-17852860,17853891-17853942, 17854054-17854179,17854291-17854373,17855127-17855309, 17855731-17855947,17856156-17856299,17856375-17856446, 17857166-17857230,17857517-17857584,17857968-17858007, 17858843-17859013 Length = 521 Score = 35.1 bits (77), Expect = 0.056 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMY-DQEKKKLG 259 K+F+G LP NVT+ ++ F +YG + ++ I+ Q+ K G Sbjct: 135 KLFIGMLPKNVTDAEMTDLFSQYGNIKDLQILRGSQQTSKAG 176 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 34.7 bits (76), Expect = 0.074 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GGL E LR F YG+V+E I+ D+E Sbjct: 32 KLFVGGLSYGTDEQSLRDTFANYGQVIEAKIINDRE 67 >04_03_0876 + 20493213-20493339,20493574-20493642,20493745-20493890 Length = 113 Score = 34.7 bits (76), Expect = 0.074 Identities = 21/61 (34%), Positives = 31/61 (50%) Frame = +2 Query: 59 IVTRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 +V+R P L RG Y ++F+GGL TE L F +YG+V+E I+ D Sbjct: 13 LVSRRESPAAYARPFLLTHSRGITY-RLFIGGLSQFATEDSLAEAFSQYGQVLEATIVTD 71 Query: 239 Q 241 + Sbjct: 72 K 72 >03_02_0613 - 9848514-9848539,9848942-9849200,9849326-9849365, 9849952-9850117,9850228-9850756 Length = 339 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +2 Query: 80 PKPCNPRTLQKPKRGGG---YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 P P +Q+P G KVF+GGL + LR F R+G ++E VI+ D+ Sbjct: 12 PPPPQVVQVQQPAAAFGDTTLTKVFVGGLAWETHKDTLREHFERFGDILEAVIISDK 68 >02_05_0796 + 31800256-31800528,31800635-31800758,31802642-31802771, 31804336-31804414,31804848-31805133,31805273-31805385 Length = 334 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 KVF+GGL L+ F +YG+++E V++ D+E + Sbjct: 47 KVFVGGLAWETPSKGLQDHFQQYGEILEAVVITDRETSR 85 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 V++GGL NV+E +LR F +YG V V I Sbjct: 300 VYVGGLDPNVSEDELRKAFAKYGDVASVKI 329 >10_02_0023 + 4306350-4306908,4308429-4308814,4308917-4308991, 4309330-4309539,4309649-4309961,4310035-4310130, 4310220-4310357,4310436-4310536,4310645-4310712, 4310800-4310849,4311790-4311848,4312399-4312530 Length = 728 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEK 247 ++F+GGLP + E D+RV F + G+V + I+ +++ Sbjct: 255 ELFVGGLPKDCVEEDIRVVFSQCGEVESIRIVKKRKR 291 >07_03_1175 - 24555965-24556117,24557809-24558264,24558270-24558436, 24558468-24558756,24559620-24559726,24559841-24559909, 24560001-24560109 Length = 449 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGL +T L+ F YG V+E I+ D++ K Sbjct: 32 KLFVGGLSYATDDTTLKDVFSHYGDVLEARIIIDRDTGK 70 >06_01_0824 - 6219477-6219556,6220427-6220808,6221415-6221448, 6222214-6222370,6224449-6224575,6224663-6224914 Length = 343 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 KVF+GGL LR F +YG+++E V++ D+ Sbjct: 40 KVFVGGLAWETPSEGLRRHFEQYGEILEAVVIADR 74 >04_04_1223 + 31851545-31852609,31854314-31854773,31856201-31856250, 31856333-31856463,31856569-31856665,31856759-31856950, 31857121-31857123 Length = 665 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +F+GGL NVTE L+ F YG+V+ V I Sbjct: 526 IFVGGLDPNVTEDVLKQVFAPYGEVVHVKI 555 >09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801, 1161732-1161869,1162184-1162273,1162354-1162431, 1162510-1163166,1163245-1163363,1164305-1164584 Length = 662 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 + V++ L N TE DL+ FG++G + V+M Sbjct: 218 FNNVYVKNLSENTTEDDLKEIFGKFGTITSAVVM 251 >07_03_1586 - 27929947-27930056,27930143-27930286,27930377-27930704, 27931189-27931404,27932099-27932284,27932439-27932521, 27932621-27932752,27932943-27932999,27933352-27933412, 27933807-27933889,27933975-27934134 Length = 519 Score = 32.7 bits (71), Expect = 0.30 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+G LP +V E ++ F +YG + ++ ++ +K + Sbjct: 125 KLFIGMLPRDVKENEVSALFSQYGNIRQLKVLRSPQKTR 163 >01_06_0006 - 25517892-25517935,25518156-25518276,25518598-25518733, 25519189-25519280,25519358-25519426,25519710-25519821, 25519897-25520015,25520302-25520355,25520811-25520891, 25520968-25521051,25521124-25521315,25521633-25521746, 25521832-25521978,25522066-25522302,25522762-25522810, 25522894-25523027,25523124-25523324,25523532-25523701, 25523773-25523875,25524198-25524361,25525015-25525055, 25525144-25525187 Length = 835 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/32 (37%), Positives = 24/32 (75%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 +V + GLPS ++ DL +F +YGK+++++I+ Sbjct: 16 QVVIRGLPSELSYADLADYFIKYGKIVDLIII 47 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 ++ L GLP V+ D+ FF YG V++ I E K Sbjct: 105 RITLDGLPWTVSNDDIVHFFSPYGTVVDHQITQKDENK 142 >01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668, 2986798-2986893,2987003-2987042,2987760-2987887 Length = 305 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +2 Query: 119 RGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 R GG ++++G L S DL FGRYG+V V + ++ Sbjct: 13 RYGGNTRLYVGRLSSRTRTRDLEDLFGRYGRVRYVDMKHE 52 >10_08_0154 + 15266430-15266953,15267748-15267820,15267893-15267949, 15268248-15268303,15269584-15269797,15270497-15270538, 15270661-15270735,15270820-15270903,15271880-15271944, 15272436-15272655,15272820-15272908,15273326-15273440, 15273519-15273554 Length = 549 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 125 GGYPKVFLGGLPSNVTETDLRVFFGRYGKV 214 GG K+++G L SN+TE LR F +G+V Sbjct: 287 GGARKLYVGNLHSNITEDQLRQVFEPFGQV 316 >08_02_0526 + 18184146-18184168,18184247-18184438,18184846-18184954, 18185071-18185220,18185973-18186136,18186273-18186359, 18187083-18187137,18187911-18188333 Length = 400 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +++ GL + VTE DL FF + GKV ++ D K+ Sbjct: 85 LYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKE 122 >08_02_0162 + 13464698-13464974,13465719-13465837,13465920-13466579, 13466686-13466763,13466849-13466938,13467241-13467378, 13467730-13467738 Length = 456 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +2 Query: 107 QKPKRGGGYPK---VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 Q+ + G PK V++ L + TE +L+ FG++G + VV+M + + K Sbjct: 206 QERENVSGNPKFNNVYVKNLSESTTEDNLKEIFGKFGPITSVVVMREGDGK 256 >02_04_0289 + 21615745-21616155,21617417-21617870,21618162-21618217, 21618307-21618437,21618565-21618727 Length = 404 Score = 31.9 bits (69), Expect = 0.52 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +++GGL N TE +LR F +YG + V I Sbjct: 308 IYVGGLDPNATEDELRKAFAKYGDLASVKI 337 >01_07_0243 + 42240553-42240750,42241114-42241255,42242327-42242442 Length = 151 Score = 31.9 bits (69), Expect = 0.52 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 KVF+GGL + +R +F ++G ++E V++ D+ Sbjct: 22 KVFVGGLAWETQKEGMRGYFEQFGDILEAVVITDK 56 >01_06_1408 - 37088014-37088448,37088892-37089167,37090777-37092297 Length = 743 Score = 31.9 bits (69), Expect = 0.52 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +2 Query: 38 KMLIICIIVTRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGR-YGKV 214 +M + + V R+ D + R+ ++PK G F GGLP + + + R GKV Sbjct: 468 EMKAVIVAVVRSFDIEAI-ARSSRRPKFAPGLTATFAGGLPPTTWDAEASAAWDRASGKV 526 Query: 215 MEVVI 229 E+VI Sbjct: 527 AELVI 531 >03_02_0346 - 7666500-7666646,7666744-7666902 Length = 101 Score = 31.5 bits (68), Expect = 0.69 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 + K+F+GGLP +R F ++G+++E V++ D+ Sbjct: 7 FTKLFVGGLPWETRGDAVRRHFEQFGEIVEAVVIADK 43 >03_01_0160 + 1302366-1302731,1303318-1303364,1303455-1303800 Length = 252 Score = 31.5 bits (68), Expect = 0.69 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 Query: 113 PKRGGGYPKVFLGGLPSNVTETDLRVFF 196 PK+ G ++G L +VTETDLR FF Sbjct: 166 PKKADGCLSAYVGNLKWDVTETDLRDFF 193 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +2 Query: 80 PKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRVFFGRYG 208 P P ++ + G Y KV GLP TE ++R F R+G Sbjct: 53 PAPAAAAAAEEEEEAGIYETGKVVASGLPYTTTEAEIRELFERFG 97 >07_01_0286 + 2086630-2086856,2087052-2087067 Length = 80 Score = 31.1 bits (67), Expect = 0.91 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 ++ +GG+ ++ +T+LR FGRYG V ++ + D+ Sbjct: 8 RLSVGGVSPDMGDTELRDHFGRYGDVADIWLRRDR 42 >05_01_0112 - 757514-758444,758525-758571,759074-759236,759861-760366 Length = 548 Score = 31.1 bits (67), Expect = 0.91 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 113 PKRGGGYPKVFLGGLPSNVTETDLRVFF 196 PK GY +V++G L ++TE DL+ FF Sbjct: 260 PKMIEGYNRVYVGNLAWDITEDDLKKFF 287 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 KV++GG+P +E D+R FF G + V M E K Sbjct: 175 KVYVGGIPYYSSEDDIRSFFEACGSITSVDCMTFPESGK 213 >07_03_1378 + 26158233-26158562,26159075-26159176,26159551-26159850, 26160006-26160068 Length = 264 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 KVF+G LP +V L F + G V V ++YD++ Sbjct: 81 KVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRQ 116 >07_01_0628 - 4691991-4692806,4694291-4694293,4694527-4694637 Length = 309 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVME 220 ++F+GGL + TE L F YGKV+E Sbjct: 8 RIFVGGLSWDTTERTLERAFSEYGKVIE 35 >04_04_0435 - 25170348-25170593,25170989-25171189,25171580-25171756, 25172284-25172418,25173131-25173262,25173292-25173369, 25173452-25174108,25174210-25174328,25175897-25176173 Length = 673 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 + VF+ L + T+ DL FG YG + VIM + K Sbjct: 217 FNNVFVKNLSESTTKEDLVKIFGAYGNITSAVIMVGMDGK 256 >08_02_1098 - 24291138-24291851,24292607-24292861 Length = 322 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 107 QKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +KP + G +VF+ GL + E DL F RYG V EV I Sbjct: 6 RKPPKDG---RVFVRGLAAGTGEADLLRHFDRYGVVDEVSI 43 >07_02_0019 + 11877119-11879984,11880316-11880389,11881293-11881511, 11881557-11881679,11881759-11881859,11881938-11881990, 11882084-11882269,11882677-11882894 Length = 1279 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/36 (33%), Positives = 27/36 (75%), Gaps = 2/36 (5%) Frame = +3 Query: 282 IIQGNLV--V*QIEFKIDIVLSIVCIYHLLILLISV 383 I+ GNL+ + ++EFK ++++IVCI ++++ L+ + Sbjct: 1138 ILGGNLIKGLRKLEFKHTVIIAIVCIRYMILPLVGI 1173 >07_01_0413 - 3155080-3155274,3155628-3155933,3156062-3156163, 3156262-3156705 Length = 348 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 110 KPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 +P G ++F+G LP +T ++ F G+V V I+YD+ Sbjct: 110 RPALGQEPGRLFVGNLPYTMTSGEISQTFSEAGRVDNVQIIYDK 153 >02_01_0304 + 2037718-2037939,2038169-2038384,2038862-2039329, 2039419-2040171 Length = 552 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 122 GGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEV 223 GG ++F+GG+ V DL F G+V V Sbjct: 12 GGAVARIFVGGISEGVAAADLEAMFASVGRVAGV 45 >12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-106310, 106787-106825,107026-107109,107193-107241,107331-107422, 107680-107809,107906-107982,108058-109676,110024-110221, 110287-110825 Length = 1109 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/33 (39%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = +2 Query: 140 VFLGGLPSNVTETDL---RVFFGRYGKVMEVVI 229 V++ GLP+N+ + R +FG+YGKV++V + Sbjct: 117 VYIIGLPANLCNESILERREYFGQYGKVLKVSV 149 >11_01_0014 + 108647-108816,109704-109803,109891-110018,110232-110394, 110491-110603,111080-111118,111319-111402,111486-111534, 111624-111715,111999-112128,112225-112301,112377-113995, 114348-114545,114635-115173 Length = 1166 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/33 (39%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = +2 Query: 140 VFLGGLPSNVTETDL---RVFFGRYGKVMEVVI 229 V++ GLP+N+ + R +FG+YGKV++V + Sbjct: 174 VYIIGLPANLCNESILERREYFGQYGKVLKVSV 206 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEV 223 +VF+GGL + E D+R F + G++ EV Sbjct: 237 EVFVGGLHRDAKEDDVRAVFAKAGEITEV 265 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +F+ G+P++ L+ F ++GK+ VV+ D K Sbjct: 413 IFVDGIPTSWDHAQLKEIFKKHGKIESVVLSRDMPSAK 450 >01_06_1799 + 39948481-39948607,39948694-39948762,39948859-39948965, 39949257-39949406 Length = 150 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GGL N + L+ F +G V E ++ D+E Sbjct: 38 KLFVGGLSWNTNDDSLKEAFTSFGDVTEARVINDRE 73 >03_06_0587 - 34921535-34922041,34922579-34922689 Length = 205 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 + F+G L + T+ L+ FG++G + E +++D+ Sbjct: 8 RCFIGNLSWSTTDESLKDAFGKFGNLTEAKVVFDK 42 >02_02_0387 - 9606744-9607475 Length = 243 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLG 259 +++ G L V LR + +GKV++ ++YD+ + G Sbjct: 139 RIYAGDLSPQVDRLRLREMYSEHGKVVQARVVYDKRGRSRG 179 >01_05_0696 - 24366857-24368200 Length = 447 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+G +P+++ L F YG++ E + +D++ K Sbjct: 178 KIFVGNVPADMPSERLLAHFAAYGEIEEGPLGFDKQTGK 216 >08_02_1039 - 23866743-23866862,23866985-23867266,23867868-23867966, 23868595-23868903 Length = 269 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +2 Query: 125 GGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVI-MYDQEKKK 253 G ++ +P + T D+R FG++G V++V + MY+ + + Sbjct: 70 GPRTRLIAQNIPWDCTADDMRALFGKHGSVVDVELSMYNSTRNR 113 >07_01_1143 - 10711023-10711884,10713603-10713826,10714253-10714522, 10715071-10715175 Length = 486 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKV 214 +++GGL S VTE DLR F +G++ Sbjct: 230 LYIGGLDSRVTEQDLRDQFYAHGEI 254 >04_03_0489 + 16503325-16503747,16503916-16503978 Length = 161 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 123 AVDTLRCSLAGCHRTL--PKPISGYFSDAMGRSWRWSLCMIKR 245 A+D+ C++ R L P +G+ D GR WRW C +R Sbjct: 94 AIDSRYCAVIAHARDLLPPHRSAGWVGD--GREWRWRRCSTER 134 >04_03_0283 + 13887388-13887573,13887711-13887806,13888517-13888637, 13888734-13888840,13888949-13889166,13890219-13890396, 13890492-13890611,13891601-13891687,13892401-13892511, 13892618-13893439 Length = 681 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 48 LFVLLSPGPSTLSRAILALFKNRNVAVDTLRCSLAGCHRT 167 +F+L + I+ L + NV T+ C +GCHR+ Sbjct: 13 IFILTMIALPLVPYTIMRLCRAANVKAKTIHCRCSGCHRS 52 >03_03_0130 - 14699658-14699723,14699828-14700109,14700444-14700545, 14701038-14701385 Length = 265 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 +VF+G LP +V L F + G V V ++YD+ Sbjct: 87 RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDK 121 >03_01_0373 - 2904914-2904949,2905030-2905144,2906446-2906534, 2906670-2906889,2907921-2907985,2908619-2908879, 2909204-2909417,2910643-2910698,2910891-2910947, 2911043-2911115,2912711-2913225 Length = 566 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 125 GGYPKVFLGGLPSNVTETDLRVF 193 GG K+++G L SN+TE LR F Sbjct: 284 GGARKLYVGNLHSNITEDQLRQF 306 >12_02_0849 - 23640091-23640279,23640537-23640677,23640756-23642203, 23642300-23642372,23642452-23642572,23642689-23642791, 23642979-23643052,23643140-23643285,23643368-23643476, 23643580-23643704,23643989-23644342,23644440-23644503, 23644581-23645032 Length = 1132 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFF-GRYGKVMEVVIM 232 K+F+GGLP +V L FF +G V E V++ Sbjct: 528 KIFVGGLPPSVGAEYLTEFFTAEFGPVEEAVVI 560 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +F+GGL +VT+ L+ F YG V+ V I Sbjct: 291 IFVGGLDPSVTDDMLKQVFTPYGDVVHVKI 320 >07_03_0188 - 14846308-14846690,14847136-14847247 Length = 164 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +1 Query: 121 WRWIP*GVPWRAAIERYRNRSQGIFRTLWEGHGGGHYV*SREEKVRG 261 W W G A +R R +FR L +G GG + SR + RG Sbjct: 27 WVWFMPGFTTNAEQQRRREGGAPVFRQLEDGDAGGGWC-SRTPRFRG 72 >03_02_0609 - 9823120-9823573,9823903-9824102,9824240-9824335, 9824454-9824567,9824711-9824774,9825206-9825312 Length = 344 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGK 211 G ++++G L S DL FGRYG+ Sbjct: 9 GSTRLYVGRLSSRTRSRDLEYLFGRYGR 36 >11_06_0418 - 23317077-23317343,23317614-23317787,23317886-23317971, 23318125-23318244,23318338-23318368,23318457-23318532, 23318672-23318759,23318877-23318938,23319041-23319117, 23319890-23319992,23320237-23320298,23321116-23321289, 23322160-23322405 Length = 521 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 G+ +F+G L VT+ L FF + + +M+DQ+ Sbjct: 242 GHFNIFVGDLCPEVTDAALFAFFAGFTSCSDARVMWDQK 280 >07_03_1347 + 25932185-25932748,25933151-25933755,25935797-25936214, 25936433-25936555,25936775-25936989,25937157-25937412, 25937844-25938149,25938764-25938820,25939635-25939685 Length = 864 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 149 GGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 GG+ S ++ L FF RYG V+ V++ D Sbjct: 463 GGVASIISPVHLESFFTRYGVVIATVLLRD 492 >03_05_0066 - 20455976-20456161,20456251-20456347,20456608-20456738, 20456814-20456869,20457498-20457543 Length = 171 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 VF+GGL +VT+ L+ F YG+++ V I Sbjct: 35 VFVGGLDPSVTDEVLKQAFSPYGELVYVKI 64 >02_01_0447 - 3220489-3220560,3221287-3221420,3221500-3221731, 3221817-3222015,3222101-3222181,3222260-3222315, 3222493-3222623,3222700-3222847,3224151-3224321, 3224417-3224775,3224898-3225189 Length = 624 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +3 Query: 66 PGPSTLSRAILALFKNRNVAVDTLRCSLAGCHRTLPKPI 182 P PST S + + KN V D RC R L +PI Sbjct: 257 PTPSTFSHEVFSKIKNNKVVFDIYRCK--DVIRHLERPI 293 >01_01_0955 - 7494486-7496327 Length = 613 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 113 PKRGGGYPKVFLGGLPSNVTETDLRVFFGRY 205 P+R GG +VF G+P + T+ VF Y Sbjct: 164 PRRAGGPGQVFAAGVPLWIPNTERNVFPANY 194 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,371,462 Number of Sequences: 37544 Number of extensions: 384212 Number of successful extensions: 958 Number of sequences better than 10.0: 77 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -