BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1167 (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 39 0.005 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 37 0.019 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 36 0.033 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 36 0.033 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 35 0.075 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 33 0.17 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 33 0.23 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) 33 0.30 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 33 0.30 SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) 33 0.30 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 32 0.40 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 32 0.40 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.40 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 32 0.40 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.2 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 30 2.1 SB_15823| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) 30 2.1 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 29 2.8 SB_27387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_58467| Best HMM Match : 7tm_1 (HMM E-Value=3.6e-10) 29 4.9 SB_34087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_7741| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-05) 29 4.9 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 28 6.5 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 28 8.6 SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) 28 8.6 SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) 28 8.6 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 41.5 bits (93), Expect = 7e-04 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = +2 Query: 56 IIVTRTIDPKPCNPR----------TLQKPKRGGGYP-KVFLGGLPSNVTETDLRVFFGR 202 I+ +TIDPKP PR + P+RG KVF+GGL TE DL+ +F Sbjct: 165 ILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSANDGKVFIGGLAFGTTEEDLKEYFST 224 Query: 203 YGKV 214 YG V Sbjct: 225 YGMV 228 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/38 (44%), Positives = 28/38 (73%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 V++G LP ++T +DL F RYGKV++V I+ D+E ++ Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRE 49 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 + K+F+GG+P + LR FF ++G++ E V++ D+ KK Sbjct: 9 FTKLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKK 49 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGL T LR +F YG++ +VV++ D KK Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKK 53 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 36.7 bits (81), Expect = 0.019 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 116 KRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 K +P V++GGL +VTE L F ++G V +VVI+ D+ K Sbjct: 519 KMAASFP-VWIGGLSEDVTENVLLELFNKFGPVKDVVILRDESGK 562 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 35.9 bits (79), Expect = 0.033 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 K+F+GGL N TE L+ +F ++G +++ VIM Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIM 82 Score = 32.3 bits (70), Expect = 0.40 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 7/73 (9%) Frame = +2 Query: 56 IIVTRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRVFFGR------YGKV 214 ++ R I+PK PR P+ K+F+GGL S E D++ +F G+V Sbjct: 112 VLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEV 171 Query: 215 MEVVIMYDQEKKK 253 ++V + D++ K Sbjct: 172 IDVDLKRDRDNPK 184 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 35.9 bits (79), Expect = 0.033 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKV 214 K+F+GGL +N +E D++ +F ++GKV Sbjct: 184 KIFIGGLSTNTSEEDMKKYFSQFGKV 209 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 34.7 bits (76), Expect = 0.075 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEV 223 +VF+G LPS V + D+ F +YG ++E+ Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTILEI 386 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEV 223 +V+LG LP TE D+R FF YG++ ++ Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDI 32 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+G +P E DLR F YG++ E+ I+ D+ Sbjct: 171 KLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDK 205 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 K+F+G + + E DLRV F +G + E+ ++ Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTIEELTVL 246 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 KVF+G + V +L+ FFG +G V+ I+ D+ KK+ Sbjct: 80 KVFVGNIGFKVRARELKDFFGYFGDVVYAQIIMDRVKKR 118 >SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) Length = 260 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLGVR 265 G ++ + +P + DLR FG +G + +V I+Y++ K VR Sbjct: 66 GPKRLHVTNIPFRFRDNDLRQMFGSFGVIADVEIIYNERGSKHAVR 111 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 32.7 bits (71), Expect = 0.30 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 74 IDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGR-YGKVMEV 223 IDPKP P + KP K+F+GGL ++ +R +FG+ Y V E+ Sbjct: 86 IDPKPAAP--IGKPPHLR-VKKIFVGGLKPETSDEKIREYFGKAYAPVKEI 133 Score = 31.9 bits (69), Expect = 0.53 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 K+F+GGL T+ L+ +F +YG+++ V I D Sbjct: 30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMD 63 >SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) Length = 694 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 152 GLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 GL TE DLR F +YG V + I+YD + K+ Sbjct: 187 GLSLYTTERDLRPVFEKYGPVEAIQIVYDHQAKE 220 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 32.3 bits (70), Expect = 0.40 Identities = 12/30 (40%), Positives = 23/30 (76%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +++GG+ ++++E + FGRYG+V +VVI Sbjct: 330 IWVGGVTNSLSEQQVERHFGRYGRVTKVVI 359 Score = 31.5 bits (68), Expect = 0.70 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 +++G LP N+ E D+ F RYG+V V I+ Sbjct: 8 LWVGNLPENIREEDIVKHFTRYGRVESVKIL 38 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +F+G + T DL+ F RYG+V++V I Sbjct: 251 LFVGNIEKTTTYGDLKEAFERYGEVIDVDI 280 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 32.3 bits (70), Expect = 0.40 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 ++F+ G TE++LR FF YG V E I+ D+ Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVVKESKIVRDK 43 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 32.3 bits (70), Expect = 0.40 Identities = 20/72 (27%), Positives = 36/72 (50%) Frame = +2 Query: 38 KMLIICIIVTRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVM 217 K+L I+V T K ++ K+ G ++++G L N+TE ++ F +G V Sbjct: 210 KLLGAPIMVMLTQAEKNRLAAEAERLKQPLGPTRLYVGSLHFNITEAMVKAVFEPFGTVD 269 Query: 218 EVVIMYDQEKKK 253 V ++YD E + Sbjct: 270 SVQLIYDSETNR 281 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 32.3 bits (70), Expect = 0.40 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLGV 262 +++ LP N E L F +YGKV+ I+ D++ GV Sbjct: 181 LYIQNLPQNCDEAMLENMFSKYGKVISTRILRDKDTNSKGV 221 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +2 Query: 98 RTLQKP---KRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 RT+Q P K+G +F+ L + E D+ +F YG+V +V I+ D+E K Sbjct: 304 RTVQLPNEEKQGVRERTLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGK 358 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVV 226 +++GGLPS+ TE +R F ++G V+E V Sbjct: 159 IYVGGLPSHFTEQTVREHFKKFG-VIEAV 186 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKV 214 KVF+GGLP ++ E ++ F R+G + Sbjct: 345 KVFVGGLPPDIDEDEIHASFCRFGSL 370 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 VF+G +P +E L+ F G V+ +++D+E K Sbjct: 27 VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGK 64 >SB_15823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 135 LRCSLAGCHRTLPKPISGYFSDAMGRSWRWSLCMIKRR 248 LR GCH + K + G+ + + GR+ R+ C + RR Sbjct: 562 LRGVATGCHTGVVKMLLGWGAKSFGRTMRFMACHLPRR 599 >SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) Length = 67 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYG--KVMEVVI 229 +V+LG LP E D++ FF YG K+ E+++ Sbjct: 4 RVYLGRLPYGTREDDVKKFFYTYGRFKIREIIL 36 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEV 223 KV+ G LP+ TE DL +GKV EV Sbjct: 4 KVYCGRLPATATEKDLENLVKVFGKVREV 32 >SB_27387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 51 FVLLSPGPSTLSRAILALFKNRNVAVDTLR 140 F LL P++L+RA++A+F + V T+R Sbjct: 31 FYLLQTSPASLARAVMAVFVTTHKTVKTIR 60 >SB_58467| Best HMM Match : 7tm_1 (HMM E-Value=3.6e-10) Length = 340 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 480 STSRQCPLLNVVGTFRCLWNIKMQTSIY 563 ST C N+ GTF+CL MQ++IY Sbjct: 168 STFAFCAANNIGGTFQCLCVFTMQSAIY 195 >SB_34087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -2 Query: 511 TFSRGHCLDVEYLLMVIDKYCIEH*K*LLY*KKTFNCLVNNY 386 T S HC+ YL+ D C +H K LLY KK + N Y Sbjct: 46 TSSLEHCMGDVYLMHSKDSQCPKHLKDLLY-KKELEEVFNEY 86 >SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1148 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +2 Query: 80 PKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 P P P QK K G VF+GGLP ++ E + F G++ + I Sbjct: 334 PPPDMPMQKQKEKPEG-CRTVFIGGLPESINEHIINEIFYVCGEITSIRI 382 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEV 223 +++GGL VTE DLR F ++G++ + Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGELRSI 333 >SB_7741| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-05) Length = 253 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 480 STSRQCPLLNVVGTFRCLWNIKMQTSIY 563 ST C N+ GTF+CL MQ++IY Sbjct: 96 STFAFCAANNIGGTFQCLCVFTMQSAIY 123 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 183 RSVSVTFDGSPPRNTLGYPPPRFG 112 R+++VT SP LG+PPP+ G Sbjct: 237 RNIAVTLAISPTNGMLGHPPPKQG 260 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEV 223 VF+G LP + + L+ +F +YG+V V Sbjct: 23 VFVGNLPLTLKKKALKKYFSKYGEVESV 50 >SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) Length = 1130 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +3 Query: 57 LLSPGPSTLSRAILALFKNRNVAVDTLRCSLAGCHRTLPKPISGYFSDAMGRSW 218 L G S ++ +++F+ R VAV T LA HR P S D GR W Sbjct: 809 LAGQGGSGKTKWAVSMFRGRKVAVLTPENDLAHDHRNNP---SSRLHDIKGRIW 859 >SB_34102| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 628 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 228 MTTSMTFP*RPKNTLRSVSVTFDGSPPRN 142 M+T+ T P P LRS T DG PP N Sbjct: 1 MSTAATLPLTPPPLLRSWQPTPDGPPPDN 29 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,884,490 Number of Sequences: 59808 Number of extensions: 475961 Number of successful extensions: 1167 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1165 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -