BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1167 (713 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 53 2e-07 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 53 2e-07 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 53 2e-07 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 51 9e-07 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 51 9e-07 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 49 3e-06 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 46 2e-05 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 46 2e-05 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 46 2e-05 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 46 2e-05 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 46 2e-05 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 45 6e-05 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 44 1e-04 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 42 4e-04 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 40 0.001 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 40 0.002 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 38 0.007 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 38 0.009 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 37 0.012 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 37 0.015 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 37 0.015 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 37 0.015 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 36 0.020 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 36 0.020 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 36 0.020 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 36 0.020 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 36 0.020 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 36 0.027 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 35 0.047 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 35 0.047 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 35 0.047 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 35 0.062 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 35 0.062 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 35 0.062 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 35 0.062 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 35 0.062 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 35 0.062 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 35 0.062 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 35 0.062 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 34 0.081 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 34 0.081 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 34 0.081 At2g47310.1 68415.m05906 flowering time control protein-related ... 34 0.081 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 34 0.081 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 34 0.11 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 34 0.11 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 34 0.11 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 34 0.11 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 33 0.14 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 33 0.14 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 33 0.19 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 33 0.19 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 32 0.33 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 32 0.33 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 32 0.33 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 32 0.33 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 32 0.33 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 32 0.33 At5g60170.1 68418.m07543 RNA recognition motif (RRM)-containing ... 32 0.43 At3g45630.1 68416.m04928 RNA recognition motif (RRM)-containing ... 32 0.43 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 31 0.57 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 31 0.57 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 31 0.57 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 31 0.76 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 31 1.0 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 31 1.0 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 30 1.3 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 30 1.3 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 1.3 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 1.3 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 30 1.3 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 30 1.3 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 30 1.3 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 30 1.8 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 30 1.8 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 30 1.8 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 30 1.8 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 29 2.3 At5g28390.1 68418.m03447 RNA recognition motif (RRM)-containing ... 29 2.3 At5g12190.1 68418.m01430 RNA recognition motif (RRM)-containing ... 29 2.3 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 29 3.1 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 29 3.1 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 29 4.0 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 29 4.0 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 29 4.0 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 29 4.0 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 29 4.0 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 28 5.3 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 28 5.3 At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing ... 28 5.3 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 28 5.3 At5g66010.1 68418.m08312 heterogeneous nuclear ribonucleoprotein... 28 7.1 At5g65410.1 68418.m08226 zinc finger homeobox family protein / Z... 28 7.1 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 28 7.1 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 28 7.1 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 28 7.1 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 28 7.1 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 28 7.1 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 27 9.3 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 27 9.3 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 27 9.3 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 27 9.3 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 27 9.3 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 27 9.3 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 27 9.3 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 27 9.3 At2g28530.1 68415.m03466 RNA recognition motif (RRM)-containing ... 27 9.3 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 27 9.3 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 27 9.3 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = +2 Query: 92 NPRTLQKPKRGGG--YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +P L P GGG K+F+GGLPS++TE + + +F ++G + +VV+MYD ++ Sbjct: 94 SPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQR 149 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ + E LR +F YG V+E VIM D+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR 41 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = +2 Query: 92 NPRTLQKPKRGGG--YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +P L P GGG K+F+GGLPS++TE + + +F ++G + +VV+MYD ++ Sbjct: 94 SPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQR 149 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ + E LR +F YG V+E VIM D+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR 41 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = +2 Query: 92 NPRTLQKPKRGGG--YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +P L P GGG K+F+GGLPS++TE + + +F ++G + +VV+MYD ++ Sbjct: 94 SPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQR 149 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ + E LR +F YG V+E VIM D+ Sbjct: 7 KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDR 41 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 50.8 bits (116), Expect = 9e-07 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +2 Query: 92 NPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 N ++Q G G K+F+GGLPS+VTE+D + +F ++G +VV+MYD ++ Sbjct: 93 NSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQR 147 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ + E L+ +F +G+V+E VI+ D+ Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR 41 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 50.8 bits (116), Expect = 9e-07 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +2 Query: 92 NPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 N ++Q G G K+F+GGLPS+VTE+D + +F ++G +VV+MYD ++ Sbjct: 93 NSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQR 147 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ + E L+ +F +G+V+E VI+ D+ Sbjct: 7 KLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDR 41 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 5/59 (8%) Frame = +2 Query: 92 NPRTLQKPKRGGG-----YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +P L P GG K+F+GGLPS++TE + + +F ++G + +VV+MYD ++ Sbjct: 103 SPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQR 161 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = +2 Query: 92 NPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 NP QK + K+F+GG+ + E L+ +FG+YG ++E VIM D+ Sbjct: 2 NPEE-QKMESASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDR 50 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 46.0 bits (104), Expect = 2e-05 Identities = 16/39 (41%), Positives = 29/39 (74%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGL S+VTE + + +F ++G + +VV+MYD ++ Sbjct: 34 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQR 72 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 46.0 bits (104), Expect = 2e-05 Identities = 16/39 (41%), Positives = 29/39 (74%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGL S+VTE + + +F ++G + +VV+MYD ++ Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQR 145 Score = 35.5 bits (78), Expect = 0.035 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ +E LR +F +G+V+E VIM D+ Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDR 41 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 46.0 bits (104), Expect = 2e-05 Identities = 16/39 (41%), Positives = 29/39 (74%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGL S+VTE + + +F ++G + +VV+MYD ++ Sbjct: 107 KIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQR 145 Score = 35.5 bits (78), Expect = 0.035 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ +E LR +F +G+V+E VIM D+ Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDR 41 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 46.0 bits (104), Expect = 2e-05 Identities = 18/39 (46%), Positives = 28/39 (71%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GG+PS VTE +L+ FF +YG V+E ++ D E + Sbjct: 110 KIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNR 148 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +2 Query: 122 GGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 G K+F+GGL + T T FG+YG++ + VIM D+ Sbjct: 15 GASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDR 54 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 46.0 bits (104), Expect = 2e-05 Identities = 18/39 (46%), Positives = 28/39 (71%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GG+PS VTE +L+ FF +YG V+E ++ D E + Sbjct: 110 KIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNR 148 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +2 Query: 122 GGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 G K+F+GGL + T T FG+YG++ + VIM D+ Sbjct: 15 GASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDR 54 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 44.8 bits (101), Expect = 6e-05 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GGLP +T+ + R +F YG V +V IMYDQ Sbjct: 111 KIFVGGLPPTLTDEEFRQYFEVYGPVTDVAIMYDQ 145 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ E LR F YG+V + ++M D+ Sbjct: 7 KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDK 41 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/34 (47%), Positives = 26/34 (76%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 K+F+GGL SN TE + + +F R+G+ +VV+M+D Sbjct: 121 KIFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHD 154 Score = 35.1 bits (77), Expect = 0.047 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 K+F+GG+ +E L+ +F RYG V+E V+ Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLEAVV 37 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+GGLP +T + R +F YG V + VIM DQ ++ Sbjct: 111 KIFVGGLPPALTSDEFRAYFETYGPVSDAVIMIDQTTQR 149 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ + E LR +F +G+V++V +M ++ Sbjct: 7 KLFIGGISWDTDENLLREYFSNFGEVLQVTVMREK 41 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/62 (35%), Positives = 35/62 (56%) Frame = +2 Query: 59 IVTRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 + T + K + L P G +V+LGG+P++ TE DL+ F G G+V EV IM + Sbjct: 70 VATEEEEEKKRHVELLALPPHGS---EVYLGGIPTDATEGDLKGFCGSIGEVTEVRIMRE 126 Query: 239 QE 244 ++ Sbjct: 127 KD 128 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +++ LP ++T+ L+ F +GK+++VVI Sbjct: 270 LYIKNLPRDITQERLKALFEHHGKILKVVI 299 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 7/63 (11%) Frame = +2 Query: 77 DPKPC----NPRTLQKPKRGGGYP---KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMY 235 DPKP + +P GGG K+F+GGL T + FG+YG++ + VIM Sbjct: 16 DPKPSEDIEDDDDKSQPHSGGGVDSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMK 75 Query: 236 DQE 244 D++ Sbjct: 76 DRK 78 Score = 36.3 bits (80), Expect = 0.020 Identities = 14/34 (41%), Positives = 25/34 (73%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 K+F+GG+PS+V + + + FF ++G++ E IM D Sbjct: 131 KIFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRD 164 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 K+F+GGLP + E +L+ +F YG ++E IMYD Sbjct: 158 KIFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYD 191 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GG+ T +FG++G+V++ VIM D+ Sbjct: 67 KLFVGGVSWETTAETFANYFGKFGEVVDSVIMTDR 101 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLG 259 + V++ L + T+ DL+ FG YGK+ V+M D E K G Sbjct: 28 FTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKG 70 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 37.1 bits (82), Expect = 0.012 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +2 Query: 92 NPRTLQ---KPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEK 247 NP T +P G K+F+G LP + DLR +FGR+G + + I D ++ Sbjct: 223 NPATFYGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKR 277 Score = 35.9 bits (79), Expect = 0.027 Identities = 17/63 (26%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = +2 Query: 68 RTIDPKPCNPRT-LQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 R ++ K P+ +++P + ++F+ +PS+V+E+D R F RYG++ ++ + D Sbjct: 70 RILEVKVATPKEEMRQPAKK--VTRIFVARIPSSVSESDFRSHFERYGEITDLYMPKDYN 127 Query: 245 KKK 253 K+ Sbjct: 128 SKQ 130 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 Y KVF+GGL ++R +F ++G+++E VI+ D+ K Sbjct: 16 YTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 Y KVF+GGL ++R +F ++G+++E VI+ D+ K Sbjct: 16 YTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 36.7 bits (81), Expect = 0.015 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 + V++ LP +T+ +L+ FG+YG + V+M DQ Sbjct: 224 FTNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQ 260 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 36.3 bits (80), Expect = 0.020 Identities = 13/30 (43%), Positives = 24/30 (80%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +F+GGL +NVT+ +L+ FG++G+++ V I Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELLHVKI 291 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +2 Query: 107 QKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 Q + G ++++G LP +T ++L FG G V++V I+YD+ Sbjct: 107 QTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDK 151 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 36.3 bits (80), Expect = 0.020 Identities = 13/34 (38%), Positives = 26/34 (76%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 V++GG+P ++TE DL F +YG++++V ++ D+ Sbjct: 38 VYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDK 71 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 ++F+GGL +VTE L F RYGK+ E IM ++ Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRD 48 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 ++F+GGL +VTE L F RYGK+ E IM ++ Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRD 48 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 35.9 bits (79), Expect = 0.027 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 +VF+GGLP +V E DLR G++ EV +M D++ Sbjct: 117 EVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRD 152 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 35.1 bits (77), Expect = 0.047 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 ++F+GGL VT+ DL F R+G +++ IM +++ Sbjct: 8 RIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERD 43 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 35.1 bits (77), Expect = 0.047 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 K+F+G LP NV+ET+++ F YG + ++ I+ Sbjct: 110 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQIL 141 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 35.1 bits (77), Expect = 0.047 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 K+F+G LP NV+ET+++ F YG + ++ I+ Sbjct: 101 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQIL 132 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 34.7 bits (76), Expect = 0.062 Identities = 13/41 (31%), Positives = 26/41 (63%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLG 259 K+F+G LP NV+E +++ F +YG + ++ I+ ++ G Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKG 147 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 34.7 bits (76), Expect = 0.062 Identities = 13/41 (31%), Positives = 26/41 (63%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLG 259 K+F+G LP NV+E +++ F +YG + ++ I+ ++ G Sbjct: 107 KLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKG 147 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 34.7 bits (76), Expect = 0.062 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GGL +V E L+ F +G+V EV I YD+ Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDK 76 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 34.7 bits (76), Expect = 0.062 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 ++F+G L +E DL+ FG G+V EV I+ + + KK Sbjct: 215 EIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKK 253 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 34.7 bits (76), Expect = 0.062 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 104 LQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 L P + KVF+GGL LR F +YG+++E V++ D+ Sbjct: 14 LNSPFGDTTFTKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADK 59 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 34.7 bits (76), Expect = 0.062 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GG+ + E LR F +YG+V++ I+ D+E Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRE 70 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 34.7 bits (76), Expect = 0.062 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +2 Query: 101 TLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 TL +P+ +F+GGL S+VT+ DL+ F +G+++ V I Sbjct: 293 TLTRPEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKI 335 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 34.7 bits (76), Expect = 0.062 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 + KVF+GGL ++R +F ++G+++E VI+ D+ K Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGK 56 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 34.3 bits (75), Expect = 0.081 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 V++GGLP ++TE +R F YG V+ V I+ D+ Sbjct: 9 VYVGGLPYDITEEAVRRVFSIYGSVLTVKIVNDR 42 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 34.3 bits (75), Expect = 0.081 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 +V++G LP +V L F +GKV+E ++YD+E Sbjct: 245 RVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRE 280 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 34.3 bits (75), Expect = 0.081 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 ++F+ LP TE +L F +GK+ EV ++ D+E K+ Sbjct: 262 RLFVRNLPYTATEEELMEHFSTFGKISEVHLVLDKETKR 300 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 34.3 bits (75), Expect = 0.081 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 7/61 (11%) Frame = +2 Query: 80 PKPCNPRTLQKPKR-------GGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 P PC +L+K + G K+++ + TE D+R F +YG V E+++ D Sbjct: 85 PSPCGGSSLRKRRSQSATDNADGSIAKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKD 144 Query: 239 Q 241 + Sbjct: 145 K 145 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 34.3 bits (75), Expect = 0.081 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 + V++ LP + E +LR FG++G + V+M DQ Sbjct: 228 FTNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQ 264 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GG+ ++ E LR F +YG+V++ ++ D+E Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRE 76 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 + K+++GGLP + L FF R+G+++ V ++ D+E Sbjct: 12 FTKIYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRE 49 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 104 LQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 L P + KVF+GGL LR F +YG ++E V++ D+ Sbjct: 14 LNSPFGDTTFTKVFVGGLAWETQSETLRRHFDQYGDILEAVVITDK 59 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GGL + L+ FG +GK+++ V++ D+E Sbjct: 37 KIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRE 72 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 + KVF+GGL + LR +F ++G ++E V++ D+ Sbjct: 6 FTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDK 42 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 + KVF+GGL + LR +F ++G ++E V++ D+ Sbjct: 6 FTKVFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDK 42 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 33.1 bits (72), Expect = 0.19 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +F+GGL S+VT+ DL+ F +G+++ V I Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKI 337 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 33.1 bits (72), Expect = 0.19 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 + V++ L T+ DL+ FG +G++ V+M D E K Sbjct: 118 FTNVYVKNLVETATDADLKRLFGEFGEITSAVVMKDGEGK 157 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 32.3 bits (70), Expect = 0.33 Identities = 12/30 (40%), Positives = 22/30 (73%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +F+G + +VTE DL+ FG++G+++ V I Sbjct: 280 IFVGAVDQSVTEDDLKSVFGQFGELVHVKI 309 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 32.3 bits (70), Expect = 0.33 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 Y KVF+GGL + ++ F ++G+++E V++ D+ Sbjct: 12 YTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDK 48 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 32.3 bits (70), Expect = 0.33 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 Y KVF+GGL + ++ F ++G+++E V++ D+ Sbjct: 12 YTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDK 48 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 32.3 bits (70), Expect = 0.33 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 Y KVF+GGL + ++ F ++G+++E V++ D+ Sbjct: 12 YTKVFVGGLAWETHKETMKKHFEQFGEILEAVVITDK 48 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 VF+GGL ++VT+ L+ F +YG+++ V I Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKI 292 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 32.3 bits (70), Expect = 0.33 Identities = 13/30 (43%), Positives = 22/30 (73%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 VF+GGL ++VT+ L+ F +YG+++ V I Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKI 292 >At5g60170.1 68418.m07543 RNA recognition motif (RRM)-containing protein low similarity to transcriptional repressor Not4-Np [Homo sapiens] GI:6856207; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) Length = 944 Score = 31.9 bits (69), Expect = 0.43 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 3/31 (9%) Frame = +2 Query: 140 VFLGGLPSNVTETDL---RVFFGRYGKVMEV 223 V++ GLP N+ + DL + +FG+YGKV++V Sbjct: 70 VYIVGLPLNLADEDLLQHKEYFGQYGKVLKV 100 >At3g45630.1 68416.m04928 RNA recognition motif (RRM)-containing protein similar to SP|P34909 General negative regulator of transcription subunit 4 {Saccharomyces cerevisiae}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 989 Score = 31.9 bits (69), Expect = 0.43 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 3/31 (9%) Frame = +2 Query: 140 VFLGGLPSNVTETDL---RVFFGRYGKVMEV 223 V++ GLP N+ + DL + +FG+YGKV++V Sbjct: 111 VYIVGLPLNLADEDLLQRKEYFGQYGKVLKV 141 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 31.5 bits (68), Expect = 0.57 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+GGL +R +F ++G+++E V++ D+ Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDK 57 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 31.5 bits (68), Expect = 0.57 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 + V++ L T+ +L+ FG+YG + V+M D + K Sbjct: 224 FTNVYVKNLSEATTDDELKTTFGQYGSISSAVVMRDGDGK 263 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 31.5 bits (68), Expect = 0.57 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +F+GGL ++VTE DL F +G+V+ V I Sbjct: 329 IFVGGLDADVTEEDLMQPFSDFGEVVSVKI 358 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 31.1 bits (67), Expect = 0.76 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +2 Query: 116 KRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 +R G K+F+GGL TE L F + G+V+E I+ D+ Sbjct: 28 QRRGVASKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDR 69 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+ GL ++ T LR F YG + E +++ D+ Sbjct: 76 KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDK 110 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+ GL ++ T LR F YG + E +++ D+ Sbjct: 76 KLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDK 110 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 VF +P TE D+ FF + GKV +V ++ D+ ++ Sbjct: 170 VFAYQMPLKATERDVYEFFSKAGKVRDVRLIMDRNSRR 207 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +2 Query: 77 DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 D KP T + K+F+G LP+ + + + FF ++G + V+++ Sbjct: 146 DTKPPEEETRNPQQEFRQEGKIFVGNLPTWIKKPEFEEFFRQFGPIENVILI 197 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GGL + LR F +G V++ ++ D+E Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRE 71 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GGL + LR F +G V++ ++ D+E Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRE 71 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 K+F+G LP NV L F G V V ++YD+ Sbjct: 92 KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDK 126 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 125 GGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 G +V++G L V + L F GKV+E ++YD++ Sbjct: 201 GSGNRVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRD 240 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 125 GGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 GG ++++G L N++E DLR F +G V V + D+ Sbjct: 282 GGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDE 320 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 VF + TE D+ FF R GKV +V I+ D+ ++ Sbjct: 184 VFAYQIALRATERDVYEFFSRAGKVRDVRIIMDRISRR 221 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 VF+G +P + TE LR G G V+ ++ D+E K Sbjct: 11 VFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGK 48 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GGL ++ L+ F +G+V E ++ D+E Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRE 71 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 K+F+GGL ++ L+ F +G+V E ++ D+E Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRE 71 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +F+GG+ +V + DLR F ++G+V+ V I Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKI 352 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +++G L TE+DL FGRYG + + + Sbjct: 20 LWVGSLTPETTESDLTELFGRYGDIDRITV 49 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +2 Query: 86 PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 P R ++P+ ++++G LP +V L F +GKV++ ++ D+E Sbjct: 191 PRGSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRE 243 >At5g28390.1 68418.m03447 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 180 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVI 229 +++ LP ++T+ L+ F +GK+++VVI Sbjct: 36 LYIKNLPRDITQERLKALFEHHGKILKVVI 65 >At5g12190.1 68418.m01430 RNA recognition motif (RRM)-containing protein similar to SP|P52298 20 kDa nuclear cap binding protein (NCBP 20 kDa subunit) (CBP20) (NCBP interacting protein 1) (NIP1) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 124 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKK 250 +++ LP N+T ++ FG+YG + ++ I D+ K Sbjct: 21 LYVRNLPFNITSEEMYDIFGKYGAIRQIRIGCDKATK 57 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIM 232 K+F+G L T DLR +F ++G+V++ ++ Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFGQVVDANVV 44 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLG 259 + V++ L ++++ +L FG +G VIM D E K G Sbjct: 223 FTNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKG 265 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 KVF+GGL + + + F +YG ++E VI+ D+ Sbjct: 18 KVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDK 52 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 G ++++G L S DL F RYG+V +V + D Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD 45 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 G ++++G L S DL F RYG+V +V + D Sbjct: 9 GNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD 45 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 +++ GL VTE DL F + GKV +V ++ D Sbjct: 47 LYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLD 79 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 +++ GL VTE DL F + GKV +V ++ D Sbjct: 77 LYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLD 109 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 125 GGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 G ++++G L V + L F GKV+E ++YD++ Sbjct: 246 GSGNRLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRD 285 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 125 GGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 G ++++G L V + L F GKV+E ++YD++ Sbjct: 254 GSGNRLYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRD 293 >At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing protein contains Pfam profile:PF00076 RNA recognition motif Length = 602 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 161 SNVTETDLRVFFGRYGKVMEVVIMYDQEK 247 S+ T+ D+ +FG +G V +V I Y Q++ Sbjct: 328 SSFTDEDVSNYFGNFGPVQDVRIPYQQKR 356 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYD 238 V++ L VT+ L F +YG V VV+M D Sbjct: 204 VYVKNLIETVTDDCLHTLFSQYGTVSSVVVMRD 236 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +2 Query: 131 YPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKKLG 259 + +++ L ++ ET LR FG YG+++ +M + + G Sbjct: 303 WSNLYVKNLSESMNETRLREIFGCYGQIVSAKVMCHENGRSKG 345 >At5g66010.1 68418.m08312 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to Heterogeneous nuclear ribonucleoprotein SP|P55795, SP|P31943, SP|P52597 {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 289 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 125 GGYPKVFLGGLPSNVTETDLRVFF 196 GG+P V L GLP N + D+ FF Sbjct: 80 GGFPVVRLRGLPFNCADIDIFEFF 103 >At5g65410.1 68418.m08226 zinc finger homeobox family protein / ZF-HD homeobox family protein similar to hypothetical proteins (GP|4220524)(GP|3184285|)(Arabidopsis); ZP-HD homeobox family protein GP|13374061 (Flaveria bidentis);GP:5091602 {Oryza sativa} Length = 279 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 126 VDTLRCSLAGCHRTLPKPISGYFSDA 203 +D L+C+ GCHR + YF A Sbjct: 106 IDALKCAACGCHRNFHRKELPYFHHA 131 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +2 Query: 110 KPKRGGGYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEK 247 +P +++GGL S + E D+ F YG++ + +M + K Sbjct: 217 EPPEDESIKTLYVGGLNSRIFEQDIHDHFYAYGEMESIRVMAEDGK 262 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 +++G +P ET++ FF ++G V V + +++ K Sbjct: 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGK 99 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 + F+GGL ++ LR F +YG ++E ++ D+ Sbjct: 8 RCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVLDK 42 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 G ++F+GGLP TE +R +G + ++ D+E Sbjct: 373 GPDRIFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRE 411 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 140 VFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQ 241 +++GGL S + E D+R F +G++ + I+ D+ Sbjct: 230 LYVGGLNSRILEQDIRDQFYAHGEIESIRILADK 263 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 + F+GGL + DL+ F ++G V++ I+ D+E Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRE 42 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 + F+GGL + DL+ F ++G V++ I+ D+E Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRE 42 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 + F+GGL + DL+ F ++G V++ I+ D+E Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRE 42 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 + F+GGL + DL+ F ++G V++ I+ D+E Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRE 42 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 G ++F+GGLP TE+ +R +G + ++ D+E Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRE 395 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 G ++F+GGLP TE+ +R +G + ++ D+E Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRE 395 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +2 Query: 128 GYPKVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQE 244 G ++F+GGLP TE+ +R +G + ++ D+E Sbjct: 357 GPDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRE 395 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 113 PKRGGGYPKVFLGGLPSNVTETDLRVFF 196 P+ GY +V++G L + TE D+R F Sbjct: 255 PEMVDGYNRVYIGNLAWDTTERDIRKLF 282 >At2g28530.1 68415.m03466 RNA recognition motif (RRM)-containing protein similar to SP|P34909 General negative regulator of transcription subunit 4 {Saccharomyces cerevisiae}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 236 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/33 (36%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = +2 Query: 140 VFLGGLPSNVTETDL---RVFFGRYGKVMEVVI 229 V++ LP ++ + D+ R +FG+YGKV++V + Sbjct: 111 VYVMSLPFDLADEDMFQRREYFGQYGKVVKVAM 143 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+ GLP T L F YG++ E ++ D+ K Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGK 143 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 137 KVFLGGLPSNVTETDLRVFFGRYGKVMEVVIMYDQEKKK 253 K+F+ GLP T L F YG++ E ++ D+ K Sbjct: 105 KIFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGK 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,136,063 Number of Sequences: 28952 Number of extensions: 319812 Number of successful extensions: 876 Number of sequences better than 10.0: 109 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -