BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1166 (755 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_49448| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = -2 Query: 172 CRPTACSSTPWCSVSCQ*SGC*LHSG*WSPCLGSHIPSSDGQHCRSRR*GCCCTVS 5 C+ CS++ C SC GC L+ + + C+SR G CT S Sbjct: 224 CQQVVCSASGKCDQSCDGEGCNLYCSEGAKTCNQKCQGACVTDCKSRWCGVTCTGS 279 >SB_49448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -3 Query: 567 AIVDEEQDVVFVLGGLEEPFSLVLSALL 484 +++ +E D +FVLG PF ++LS ++ Sbjct: 43 SVIGDEADCLFVLGAYHSPFEVILSVVV 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,954,074 Number of Sequences: 59808 Number of extensions: 479692 Number of successful extensions: 1239 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1239 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -