BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1164 (765 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M34667-1|AAA36452.1| 1290|Homo sapiens protein ( Human phospholi... 32 2.6 DQ297143-1|ABB84466.1| 1291|Homo sapiens phospholipase C, gamma ... 32 2.6 AL022394-3|CAA18537.1| 1290|Homo sapiens phospholipase C, gamma ... 32 2.6 AL022394-2|CAM28260.1| 1291|Homo sapiens phospholipase C, gamma ... 32 2.6 AB210028-1|BAE06110.1| 1412|Homo sapiens PLCG1 variant protein p... 32 2.6 >M34667-1|AAA36452.1| 1290|Homo sapiens protein ( Human phospholipase C-gamma mRNA, complete cds. ). Length = 1290 Score = 31.9 bits (69), Expect = 2.6 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 698 PSINIALRVLGRNNRLISVLWSDVSVAHYRCDV 600 P+ IA+R G+NNRL S SVAH+ DV Sbjct: 879 PACQIAIRPEGKNNRLFVFSISMASVAHWSLDV 911 >DQ297143-1|ABB84466.1| 1291|Homo sapiens phospholipase C, gamma 1 protein. Length = 1291 Score = 31.9 bits (69), Expect = 2.6 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 698 PSINIALRVLGRNNRLISVLWSDVSVAHYRCDV 600 P+ IA+R G+NNRL S SVAH+ DV Sbjct: 879 PACQIAIRPEGKNNRLFVFSISMASVAHWSLDV 911 >AL022394-3|CAA18537.1| 1290|Homo sapiens phospholipase C, gamma 1 protein. Length = 1290 Score = 31.9 bits (69), Expect = 2.6 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 698 PSINIALRVLGRNNRLISVLWSDVSVAHYRCDV 600 P+ IA+R G+NNRL S SVAH+ DV Sbjct: 879 PACQIAIRPEGKNNRLFVFSISMASVAHWSLDV 911 >AL022394-2|CAM28260.1| 1291|Homo sapiens phospholipase C, gamma 1 protein. Length = 1291 Score = 31.9 bits (69), Expect = 2.6 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 698 PSINIALRVLGRNNRLISVLWSDVSVAHYRCDV 600 P+ IA+R G+NNRL S SVAH+ DV Sbjct: 879 PACQIAIRPEGKNNRLFVFSISMASVAHWSLDV 911 >AB210028-1|BAE06110.1| 1412|Homo sapiens PLCG1 variant protein protein. Length = 1412 Score = 31.9 bits (69), Expect = 2.6 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = -2 Query: 698 PSINIALRVLGRNNRLISVLWSDVSVAHYRCDV 600 P+ IA+R G+NNRL S SVAH+ DV Sbjct: 1001 PACQIAIRPEGKNNRLFVFSISMASVAHWSLDV 1033 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,129,114 Number of Sequences: 237096 Number of extensions: 1930850 Number of successful extensions: 2224 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2224 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9199990470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -