BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1161 (721 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 32 0.072 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.67 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 27 3.6 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 6.2 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 8.2 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 8.2 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 32.3 bits (70), Expect = 0.072 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 315 SGCGRCRVWSMFVRNVRFSE*YFNIMRPQKLYIF 214 +GCG+ VW +VR V F E Y LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.67 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 132 ARKIRGRPENAGPDPVRNVRRFSRV 206 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 26.6 bits (56), Expect = 3.6 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 163 RVRIQSET*DDFRECHIKYIQFLRPHYIKILLAKTNITHE 282 +V + S+ D +E H+KY+Q + +++ LAK +I E Sbjct: 1069 QVDLLSKLADQEKEKHLKYLQSSYKNSLEVQLAKLDIVKE 1108 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.2 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +2 Query: 536 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 673 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 8.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 278 TNIDQTRHRPHPLPVQTRHAPV 343 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 8.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 390 FPYLHYSID*RLFTLETCCGYGYEPARHL 476 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,015,835 Number of Sequences: 5004 Number of extensions: 63823 Number of successful extensions: 173 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -