BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1161 (721 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0098 + 25560158-25560925 32 0.53 03_04_0090 + 17228253-17228403,17229062-17229129,17229238-172309... 31 0.92 06_01_0350 + 2534422-2535615 31 1.2 12_01_0796 + 7292523-7292783,7292963-7293018,7295274-7295331,729... 29 2.8 03_04_0040 - 16730622-16730873,16731005-16731340 29 2.8 06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357,199... 29 4.9 04_03_0732 + 19095320-19095827,19095848-19096621,19096863-190969... 29 4.9 02_02_0346 - 9214365-9214583,9214830-9214919,9215012-9215177,921... 29 4.9 11_08_0081 - 28216179-28216381,28216590-28216657,28217131-282172... 28 6.5 12_02_0969 - 24936399-24936699,24936779-24936949,24937032-249378... 28 8.6 12_02_0854 + 23697826-23698033,23699111-23699276,23699430-236994... 28 8.6 05_04_0162 + 18645459-18645827,18645934-18646149,18646224-186462... 28 8.6 >05_06_0098 + 25560158-25560925 Length = 255 Score = 31.9 bits (69), Expect = 0.53 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +2 Query: 299 HRPHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSP 478 HRP P P + P L +P + V I P PT F + + ++++ + T P Sbjct: 31 HRPPPPPPSSSSQPALPPSPRTVVPRTIDTTPFPTTFVQADTASFKQVVQMLTGSDTTPP 90 >03_04_0090 + 17228253-17228403,17229062-17229129,17229238-17230902, 17231002-17231143,17231648-17232399 Length = 925 Score = 31.1 bits (67), Expect = 0.92 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 6/33 (18%) Frame = +2 Query: 278 TNIDQTRH------RPHPLPVQTRHAPVLRANP 358 T IDQ H + H +PVQ H+PVL+ NP Sbjct: 324 TQIDQPSHCQRIKNQDHSVPVQKNHSPVLKTNP 356 >06_01_0350 + 2534422-2535615 Length = 397 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 583 PWNSNAQAEKKTLPGPLGGVFRP 651 PW S+A+ E+K LP PL +F P Sbjct: 42 PWRSSARLERKLLPPPLPWLFLP 64 >12_01_0796 + 7292523-7292783,7292963-7293018,7295274-7295331, 7295777-7295843,7296461-7296516,7296638-7296691, 7296836-7296961 Length = 225 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 308 HPLPVQTRHAPVLRANPYSEVTDPICRLPL 397 H L + RH P L+A P S + C+LPL Sbjct: 107 HSLIIPKRHFPSLQATPPSVIAAICCKLPL 136 >03_04_0040 - 16730622-16730873,16731005-16731340 Length = 195 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 565 IWFGTRRAPHLRRCPDTLCDLENSGEGCTWRCRAG 461 +W G R P + RC D + E +G G CR G Sbjct: 128 VWVGLERRPGVERCRDG--EKEEAGGGARVHCRGG 160 >06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357, 1990434-1990621,1990711-1990835,1990988-1991039, 1991585-1991874,1992229-1992307,1992527-1992657 Length = 464 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 314 LPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEAL 427 +P Q + A + A+P + V C LP P+LF L L Sbjct: 292 IPYQFQEATSILASPLAHVPASSCPLPAPSLFSSLPLL 329 >04_03_0732 + 19095320-19095827,19095848-19096621,19096863-19096906, 19097191-19097250 Length = 461 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 302 RPHPLPVQTRHAPVLRANPYSEVTDP 379 RP+PL V +RHA VL + V DP Sbjct: 133 RPNPLDVVSRHAGVLSRGDHCLVVDP 158 >02_02_0346 - 9214365-9214583,9214830-9214919,9215012-9215177, 9215601-9215911,9215944-9216566,9216779-9216968, 9217096-9217197,9217285-9217425,9217815-9218411, 9219126-9219286,9220709-9220824,9221538-9221654, 9221746-9221808,9221879-9221949 Length = 988 Score = 28.7 bits (61), Expect = 4.9 Identities = 21/61 (34%), Positives = 26/61 (42%) Frame = +2 Query: 518 IRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPRRTLVFKDEGT 697 I+ P M S + + GFHG L+ KL PDL + HF LVF G Sbjct: 188 IKLYPHM--SGEQKRLIEGAGFHGLVDLKCS-KLRPDLCSWLMEHFNPATNQLVFPGRGA 244 Query: 698 I 700 I Sbjct: 245 I 245 >11_08_0081 - 28216179-28216381,28216590-28216657,28217131-28217298, 28217370-28217436,28217509-28217576,28218256-28218420, 28218490-28218556,28218629-28218696,28219855-28219992, 28220189-28220353,28221227-28221304,28221380-28221532, 28222753-28222823,28223077-28223203,28223306-28223565, 28223679-28223842,28224287-28224450,28225873-28226159 Length = 826 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = +2 Query: 260 LKRTLRTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP--ICRLPLPTLFYRLEALHL 433 +K + N+D RP P PV LRA PY P + + L + L ++++ Sbjct: 1 MKPSPAANLDVRVERPRPPPVHPHRPGSLRARPYYRRWTPWIVAAIALSCVVVFLVSMYV 60 Query: 434 GDLLR 448 D R Sbjct: 61 NDCPR 65 >12_02_0969 - 24936399-24936699,24936779-24936949,24937032-24937852, 24937946-24938407,24938486-24938890 Length = 719 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 480 VHPSPEFSRSQRVSGHRRKCGALRVP 557 VHP+P S HR C ++ VP Sbjct: 248 VHPTPRAQHDTNPSHHRSSCASIEVP 273 >12_02_0854 + 23697826-23698033,23699111-23699276,23699430-23699466, 23699531-23700145 Length = 341 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +3 Query: 276 ARTSTRPGTGRIRFPSKPDTPRSSE 350 A TST PG GR R PS P TP S+ Sbjct: 16 AATSTDPGRGRKRPPS-PSTPTPSD 39 >05_04_0162 + 18645459-18645827,18645934-18646149,18646224-18646278, 18646545-18646672,18647134-18647217,18648742-18648867, 18648949-18649086 Length = 371 Score = 27.9 bits (59), Expect = 8.6 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 288 TRPGTGRIRFPSKPDTPRSSEPILIPKLR 374 TRP TG+ P K D RS + I KLR Sbjct: 108 TRPRTGKAALPLKRDRTRSKRFLEIQKLR 136 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,039,914 Number of Sequences: 37544 Number of extensions: 478701 Number of successful extensions: 1665 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1665 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -