BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1161 (721 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical pr... 33 0.27 Z81119-8|CAB03340.1| 504|Caenorhabditis elegans Hypothetical pr... 29 3.3 AF039047-11|AAB94230.1| 354|Caenorhabditis elegans Prion-like-(... 29 4.4 >U29535-9|AAK31453.2| 2148|Caenorhabditis elegans Hypothetical protein C25H3.8 protein. Length = 2148 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +2 Query: 269 TLRTNIDQTRHRPHPLPVQ---TRHAPVLRANPYSEVTDPI 382 TL+++ID T H PHP+ VQ T+ V+ P V+ P+ Sbjct: 904 TLKSSIDITNHLPHPIAVQTEGTKGGEVMSVEPNGVVSVPL 944 >Z81119-8|CAB03340.1| 504|Caenorhabditis elegans Hypothetical protein T10H4.10 protein. Length = 504 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 208 DTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFN 68 D +L R G +G IF VR RF++ R D++ PFN Sbjct: 200 DPEFEKLVSRLAKGFENTGFLDIFCPVRILESRFLKWRQDTIFEPFN 246 >AF039047-11|AAB94230.1| 354|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 51 protein. Length = 354 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +2 Query: 284 IDQTRHRPHPLPVQTRHAP--VLRANPYSEVTDPICRLPLPTLFYRLEALHLGD 439 +D + P P P Q H P +R NP P+ + P+ L L A H+GD Sbjct: 53 VDLESNAPPPAPRQQHHVPPSAVRPNPMPP-QRPVAQQPVRAL-SALHAAHIGD 104 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,011,735 Number of Sequences: 27780 Number of extensions: 372514 Number of successful extensions: 1224 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1224 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1687292480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -