BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1160 (781 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.75 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.75 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 27 3.0 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 26 7.0 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 9.2 SPBC3E7.11c |||DNAJ protein Caj1/Djp1-type|Schizosaccharomyces p... 25 9.2 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 9.2 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.75 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 300 SGCGRCRVWSMFVRYVRFSE 359 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.75 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 484 ARKIRGRPENAGPDPVRNVRRFSRV 410 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 27.1 bits (57), Expect = 3.0 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -2 Query: 171 ADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISL 43 A GT++ +IST +P P++VSGH A R+P+ S+ Sbjct: 371 ATNGTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.8 bits (54), Expect = 7.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 271 LRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHL 140 L + L+ +P+ S+D R+F LE+ GY EP L Sbjct: 144 LNSKTSESLKSPTLSYPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 9.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 337 TNIDQTRHRPHPLPVQTRHAPV 272 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPBC3E7.11c |||DNAJ protein Caj1/Djp1-type|Schizosaccharomyces pombe|chr 2|||Manual Length = 355 Score = 25.4 bits (53), Expect = 9.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 477 FLAVRSCRFRLCAIGTILYDRRSTVSS 557 FL +R LCA GT+L D +TV S Sbjct: 221 FLGIRGVWGSLCAKGTLLKDTWNTVVS 247 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 9.2 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -1 Query: 730 GYLKRVIVTPAVYPRLLEFLHVDIQST 650 G+++R+ V YP LLE+L++ + S+ Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,243,374 Number of Sequences: 5004 Number of extensions: 68044 Number of successful extensions: 191 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 377352472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -